ELF(4 4 (p   lԞ ԞԞ((QtdRtd  + Z' )A*g}8izoC +J<^[k"V<MG+K4 ,PNn_t5R !2&1us x0uda4>vSl.rfob'{0 H/|c~h*;'\$X T[9q%7@mSJ{62Y&5]ec,C#wEIF#-"EW$3!AnQ: y U qlZ->`?YR8DFdw ;h@O(&H:K6k)a9QL!IbyDX.3"*( =m}7jTpW(\G]i  N|z$?=jB)tpeO#`g^/M  x~1%v%_PBLVsUrf  ̘v"C8PH"" \:Ǝ΢fNB: 0  pF8Dp W`  Un@"bE B+ "A $$ b^2$ B Q  !$&)*APx&Y[&I?>|ʸ+Xe߱=]MG"/%G"+~4P6yO+pt\"ĈXɩs;rwBqLj \!x xpu?+P{I~Hrq"Zr"6Jc\OZ"U2eͻ)%y3z^mG"1,YdϜKq<)Ibbsז@YesZkGq"b{II_ -%+ YtԺːYzJ#,;9W5p * ?גI;bA:"/%wԘ{kf y<9-Dw+<4)Cq2%P {fLZS%bne5 8[PYj180Ymĭ>O;:}\t̿ 9̄&ؓ/G"n/%l "bYA0%GKWu='$pZMvBrW_ %e:Q%O#Gg&d]Fq"*EHw-"VT~M ^jt ˬw9WZ~gH֪9\ | f{cg"}B "{ z N f If"q8 $U f  U7 #   $V V f> Ng-a19@vV"  .#m & &  PG#\ $N D , 64$1  '%  m eXk /}}"U84; F ZEft sA8D m<" +#k8 b"  %%zv=3#X$ q(pI^OC\3#  ;y 0 R    [4"`  + (N 6 P   d e'I$1K3 L ,%u &N i p f O Ua $#Q 6 x=  o F" _3a  }$Z  $  P   !Ȑ  3$ 1&`88 d# l    < p  (  < i, #\      ] T >!  $5  89 N H  @ , <  :  oD v8  V#h 0 , 2$ , c$ % p 8 Kp,  sX , {@< 8 KD  00 D X   8 h` @\   ]ȴ x   I"h  | (  _  ) \8 pt $  #|   c"  8 @9 w#    /D, h    D    X$ 6 \< " l '" 4 !ؐ  $  |\  # 0 $H8  P  d T i tH #4  `  6  d,  "  x h  G ] !  H d$ `!  4 (l   `   ,  T` :X @   T ^ `  , `$ @\ H  5p d!  @$ VlD h X (L  O$  vԹ@ 6 "x  E< "  " X X H 0 #@  X\$ ,H9 % !  # H T 4 Ud  l <$ # , 8 \ $ u    t$ sH, y!  $D "4 p z  8 +p  H  < $4 ] !А  &|  ܔ   >%|9  s"(  l%<  Q  9#    , !  ET PH __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize_Jv_RegisterClassesav_logavio_writeavio_r8avio_feofavio_seekav_get_packetav_append_packetav_packet_unrefav_dict_copyav_dict_freeavformat_new_streamav_dict_getavpriv_set_pts_infoabortavpriv_mpeg4audio_get_config2avpriv_align_put_bitsav_packet_get_side_datamemcpyav_default_item_nameavio_w8avio_wb32memsetavio_wl32strlenavio_wb16av_get_bits_per_sampleavio_wb64pthread_mutex_lockpthread_mutex_unlockav_muxer_iterateav_demuxer_iterateav_iformat_nextpthread_onceav_oformat_nextav_register_allav_register_output_formatav_register_input_formatavpriv_register_devicesavio_rl32avio_get_strav_dict_setav_mallocavio_readav_freeavio_sizestrncmpavio_open_dyn_bufavio_get_dyn_bufavio_put_strav_packet_freeav_freepav_crc_get_tableav_crcav_malloczav_packet_refav_reduceav_packet_allocavio_wl16avio_write_markeravio_wl64avio_put_str16leavio_close_dyn_bufav_dict_countstrcmpav_rescale_qavcodec_descriptor_getav_reallocp_arrayavio_print_string_arraystrtolav_asprintfstrstrstrchravio_printfavio_skipav_rescale_rndav_bprint_initav_bprint_append_dataav_bprint_finalizeav_bprint_charsav_realloc_favpriv_request_sampleceilavpriv_report_missing_featureavpriv_pix_fmt_bps_aviavpriv_find_pix_fmtav_get_pix_fmt_nameav_mul_qav_get_media_type_stringav_init_packetmemcmpstrspnstrcpyav_strlcpyav_strstartav_opt_set_defaultsav_opt_setmemmoveav_match_listav_strdupav_opt_freeav_opt_copyav_opt_set_dictavio_find_protocol_nameavio_checkavpriv_io_moveavpriv_io_deleteavio_open_diravio_close_diravio_free_directory_entryavio_read_dirav_gettime_relativeav_usleepav_strerrorav_reallocpavio_alloc_contextavio_context_freeavio_put_str16beavio_wl24avio_wb24avio_flushavio_rl16avio_rl64avio_get_str16leavio_rl24avio_rb16avio_rb32avio_rb64avio_get_str16beavio_rb24av_bprint_clearavio_read_partialavio_closeavio_closepavio_open2avio_openav_vbprintfavio_pauseavio_seek_timeavio_read_to_bprintavio_acceptavio_handshakebsearchav_fast_reallocav_adler32_updategmtime_ravformat_free_contextavcodec_free_contextav_parser_closeav_dict_set_intstrrchrav_reallocav_write_frameavformat_write_headerav_bprintfstrftimeav_codec_get_tagav_strlcatfstrcspnav_strndupav_strireplaceavformat_alloc_contextav_guess_formatavcodec_parameters_copyav_parser_initavcodec_alloc_context3avcodec_parameters_to_contextavformat_init_outputav_parse_timeav_gettimeav_div_qav_strnstrav_strlcatav_write_trailerav_packet_new_side_dataav_parser_parse2av_compare_tsfprintffputsfputclrintfavcodec_stringav_get_channel_nameav_display_rotation_getav_stereo3d_type_nameav_get_picture_type_charav_spherical_projection_nameav_spherical_tile_boundsav_hex_dumpav_hex_dump_logav_pkt_dump2av_pkt_dump_log2av_dump_formatav_rescaleav_fifo_freepav_dv_codec_profile2av_fifo_alloc_arrayav_timecode_initav_timecode_init_from_stringav_timecode_get_smpte_from_framenumav_fifo_sizeav_fifo_generic_writeav_fifo_drainav_thread_message_queue_freepthread_mutex_destroyavformat_alloc_output_context2av_thread_message_queue_allocav_thread_message_queue_set_free_funcpthread_mutex_initav_thread_message_queue_set_err_recvpthread_joinav_thread_message_queue_sendpthread_createav_packet_rescale_tsav_thread_message_queue_set_err_sendav_thread_message_flushav_thread_message_queue_recvputcharclosedir__errno_locationreaddir64av_append_path_componentavpriv_openrenameaccesslseek64opendirrmdirunlinkav_strcasecmpav_pix_fmt_desc_getav_get_bits_per_pixelav_packet_cloneavcodec_get_nameav_malloc_arrayav_match_extav_match_nameav_filename_number_testav_guess_codecav_find_input_formatav_probe_input_format3av_probe_input_format2av_probe_input_formatav_probe_input_buffer2av_opt_getav_probe_input_bufferav_get_channel_layout_string__isoc99_sscanfav_hash_freepav_mallocz_arrayav_hash_allocav_hash_initav_hash_get_nameav_hash_final_hexav_hash_updateav_basenameav_base64_encodemkdirav_dirnameav_stristrav_stream_get_side_dataav_strncasecmplocaltime_rllroundstrtollatofav_stristartav_strtokatoiav_codec_get_idmktimeav_small_strptimestrtoullav_timegmav_url_splitgetenvav_bprint_init_for_bufferav_md5_updateav_get_random_seedav_md5_allocav_md5_initav_md5_finalav_buffer_unrefav_buffer_allocav_fast_mallocav_dynarray_add_nofreeavpriv_new_chapterav_new_packetav_interleaved_write_frameav_get_frame_filename2getaddrinfogai_strerrorav_get_tokenfreeaddrinfoav_dynarray2_addav_q2intfloatavpriv_mpa_freq_tabavformat_get_mov_video_tagsavformat_get_mov_audio_tagsavpriv_copy_bitsav_stereo3d_allocav_stream_add_side_dataav_lfg_initavcodec_get_typeavpriv_split_xiph_headersavcodec_enum_to_chroma_posav_get_bytes_per_sampleav_realloc_arrayfmodav_fourcc_make_stringav_dovi_allocav_content_light_metadata_allocav_mastering_display_metadata_allocav_color_primaries_nameav_color_transfer_nameav_color_space_nameav_spherical_allocav_encryption_info_allocav_encryption_init_info_allocav_encryption_init_info_freeav_encryption_init_info_get_side_dataav_encryption_init_info_add_side_dataav_encryption_info_freeav_stream_new_side_dataav_get_channel_layout_nb_channelsavpriv_ac3_channel_layout_tabav_index_search_timestamphypotav_d2qav_sha_allocav_aes_allocav_sha_initav_sha_updateav_sha_finalav_aes_initav_aes_cryptav_aes_ctr_freeav_encryption_info_cloneavpriv_dict_set_timestampav_timecode_make_stringav_aes_ctr_set_full_ivav_aes_ctr_cryptav_aes_ctr_allocav_aes_ctr_initav_encryption_info_add_side_dataav_packet_add_side_dataav_timecode_check_frame_rateavpriv_toupper4avpriv_pix_fmt_bps_movstrtodavpriv_get_gamma_from_trcavpriv_find_start_codeavcodec_parameters_allocav_aes_ctr_increment_ivav_aes_ctr_get_ivav_aes_ctr_set_random_ivavcodec_parameters_freeavpriv_mpegaudio_decode_headerav_add_index_entryavpriv_mpa_bitrate_tabav_fifo_allocav_fifo_generic_readav_fifo_realloc2av_get_audio_frame_duration2av_log_onceav_rescale_q_rndav_frame_freeav_opt_set_dict2avcodec_parameters_from_contextav_packet_make_refcountedav_packet_move_refav_get_audio_frame_durationav_bsf_send_packetav_bsf_receive_packetav_packet_copy_propsav_buffer_refav_buffer_createav_get_output_timestampav_write_uncoded_frameav_interleaved_write_uncoded_frameav_write_uncoded_frame_queryavpriv_dnxhd_get_frame_sizeavpriv_dnxhd_get_hr_frame_sizeavpriv_dnxhd_get_interlacedpollgetnameinfosocketfcntl64setsockoptbindlistenconnectgetsockoptav_tree_node_allocav_tree_insertav_tree_enumerateav_tree_destroyav_callocav_tree_findav_fmt_ctx_get_duration_estimation_methodavformat_get_classavio_enum_protocolsavio_protocol_get_classav_shrink_packetavformat_get_riff_video_tagsavformat_get_riff_audio_tagsav_gcdav_opt_get_intav_opt_flag_is_setavpriv_mjpeg_bits_dc_luminanceavpriv_mjpeg_val_dcavpriv_mjpeg_bits_dc_chrominanceavpriv_mjpeg_bits_ac_luminanceavpriv_mjpeg_val_ac_luminanceavpriv_mjpeg_bits_ac_chrominanceavpriv_mjpeg_val_ac_chrominancerecvfromvsnprintfav_find_info_tagav_dict_parse_stringsendtostrtoulavformat_close_inputgetpeernameav_sdp_createav_dynarray_addgetsocknameavpriv_mpeg4audio_sample_ratesav_get_frame_filenameavformat_match_stream_specifierav_escapeavpriv_dca_sample_ratesav_adts_header_parseav_grow_packetqsortshutdownav_bsf_freeav_dict_get_stringav_bsf_list_parse_strav_bsf_get_null_filterav_bsf_initav_opt_get_key_valuepthread_cond_signalpthread_cancelpthread_cond_destroyav_fifo_spacepthread_cond_timedwaitpthread_setcancelstatepthread_cond_waitpthread_cond_initav_image_fill_linesizesav_sample_fmt_is_planarav_get_sample_fmt_nameav_bsf_get_by_nameavcodec_find_decoderav_codec_iterateav_codec_is_decoderav_frame_allocavcodec_is_openavcodec_open2avpriv_codec_get_cap_skip_frame_fill_paramavcodec_send_packetavcodec_receive_frameavcodec_decode_subtitle2avsubtitle_freeavformat_versionavformat_configurationavformat_licenseav_stream_get_r_frame_rateav_stream_set_r_frame_rateav_stream_get_recommended_encoder_configurationav_stream_set_recommended_encoder_configurationav_format_get_video_codecav_format_set_video_codecav_format_get_audio_codecav_format_set_audio_codecav_format_get_subtitle_codecav_format_set_subtitle_codecav_format_get_data_codecav_format_set_data_codecav_format_get_metadata_header_paddingav_format_set_metadata_header_paddingav_format_get_opaqueav_format_set_opaqueav_format_get_control_message_cbav_format_set_control_message_cbav_format_get_open_cbav_format_set_open_cbav_stream_get_end_ptsav_stream_get_parserav_format_inject_global_side_dataav_format_get_probe_scoreav_demuxer_openavformat_queue_attached_picturesav_add_stableav_find_default_stream_indexavformat_flushav_codec_get_tag2llrintav_find_program_from_streamav_opt_get_dict_valav_opt_set_dict_valavcodec_closeav_read_frameav_compare_modav_seek_frameavformat_seek_fileav_find_best_streamav_read_playav_read_pauseav_memdupav_new_programav_program_add_stream_indexavformat_open_inputavformat_query_codecavformat_network_initavformat_network_deinitav_guess_sample_aspect_ratioav_guess_frame_rateavformat_find_stream_infoav_opt_ptrav_bsf_allocavcodec_pix_fmt_to_codec_tagavpriv_get_raw_pix_fmt_tagsav_opt_nextav_opt_set_from_stringav_apply_bitstream_filtersav_bitstream_filter_filterav_buffer_default_freeavformat_transfer_internal_stream_timing_infoav_stream_get_codec_timebaseav_format_ffversionav_pix_fmt_get_chroma_sub_samplelibavcodec.so.58libavutil.so.56libm.so.6raiselibpthread.so.0libc.so.6__fxstat64__lxstat64libavformat.so.58LIBAVFORMAT_58GLIBC_2.4LIBAVCODEC_58LIBAVUTIL_56GLIBC_2.28GLIBC_2.7  &2p 1&% ii @&% ii @&% _J&% 6X&% e&ii p&ii @& $HL  $04 $0 4 ` d     T \ d l t          0 4 ` d          $ L P T |          @ D p t       04`d $PT <@Dlpt04`d $PT@Dpt04`d $PT  (,048<@HLx|8< 48<dhl(,(x| hlx(,X\HLx| 8<hl(,X\  D H L t x |       ! !4!8! >8><>d>h>l>>>>>>>>>>(?,?X?\????????H@L@P@T@X@\@`@d@h@l@t@|@@@@@@@@@@@@@@@@AAAA?@ABCDEFG HIJKL M$N(O,P0Q4R8S<T@UDVHWLXPYTZX[\\`]d^h_lapbtcxd|efghijklmnopqstuvwġxȡy̡zС{ԡ|ء}ܡ~  $(,048<@DHLPTX\`dhlptx|ĢȢ̢ТԢآܢ  $(,048<@DHLPTX\`dhlptx|ģȣ̣Уԣأܣ       $(,048<@DHL P!T"X#\$`%d&h'l(p)t*x,|-./012356789:;<=>?Ĥ@ȤA̤BФCԤDؤFܤHIJKLMNOPQRS TUVWX Y$Z([,\0]4^8`<a@bDdHeLfPgThXi\j`kdlhmlnpotpxq|rstuvwxyz{|}~@--( Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌxƏʌpƏʌhƏʌ`ƏʌXƏʌPƏʌHƏʌ@Əʌ8Əʌ0Əʌ(Əʌ ƏʌƏʌƏʌƏʌƏʌƏʌƏʌƏʌ@- ,0S, S CBB"R 0 0 0   D Ѝ O-$M\0X`Pd@ 0 <03#003 0&0SP0 !1X000%/P0^ P`0  0p X0@ SR Т[Z 0SG R0CU<0$2 "002 0Q0 @ R0 T >01!001 0 0 Z0РZ0 dRS \"0101$Ѝ R0 `p` 0WV``p`,! `%R00`Zp``0  `RpV0`010C0 V0 0 d , m ķ | @-Q$P1Q 0@0SA Ѝ<0D0@ 0040 0?!0`l @TP@9 $ O-0 @M'0 700L?o2,0700L?o200 Lo40\0(0@4S H'CQ<' _;0pD4到【 S`7D40 `$$ 0$`0000 0000S=`pP0S?PX c.j,(X tpƟP,d1#`Ɵ R0$0 0 0S0 0Y (0X 0110 0RB 040S M M08PP Ѝ5 P @jA0P+ P P0 S0 0000 0000 0FDP R 001;00S %  r$00$0_( R$4PP*@ B00R0S $ 0 V 4P< 4P7 `4P@p l0S LS D S } S 0$ (d $T2 $   `,P@1  @$T#   p  C0 !" $0:0 00 0Pa `L3P,l0D S& } S P#  S S 0 0 h0 Qp ABpB C #"!  " S 01$02"PP" 0 "2*@PR" n00000h"  ;70090000,"` 0 0  ]CP0P2h0P0Sp 00S`h㐁'\ PhP0h!  s  \P0R 1#h0S7  0Y~UPEh xt 0 ` FO >_  PPw  D  B u ,PP *P   ?   d1A-0 M@`P! 00S!l0 3lS`!p {tQ-,`,x-E-pWX X8  , ! 0h0S   Ѝ0S 0000pf QP&--PU S 000C?o2P  hp0S$0A `V V EA3gV U U G-Pp@T 0`V P@O-MM@PB/ D뤑p G`   W000SL Gl!0 10 =RA D!00 0 $( `P+ B00,ST 4S 02S B@ D`0 R00 P gx xP ]@VT 4S 02S BtލЍX F @- @04D@M-@T0! `000Z 00S 0 00 .P 0P`p.1,P 0-Ѝ0S000 (0R @- /P 0 0 R/ꘙ H0HH 000C S/,0M00S Ѝ/Ѝ/ ` PLLL0A0A/, M00S Ѝ/Ѝ/` \  xL L0 0R/8 @-0S (00 0  @ @-880 0R $ 00S 3/ Ѝ0 < 0@- 0@  0   R|  P0T8E !P0 @ލЍ!0 R 0!A L 7PPE E; )`P  V 0PL!0 `@ 0@`Z) P p V`P  {00H P;0000p0t00t00 '`P0 `}PP @  )`P @0 P ꠏ { ( O-p`Mg$ P0@PЍ P0@00PU& s)$ NP'}P }> ' 0@S   0  T0P0 0 'P| 0 '`   T00&[ @TPY Pꕍ v g D : 8 O-M@+PFqD딡`p P 0PP:V3 v+P.Lq  p&} $ $$ $ # & &}# ### #+ Ѝ00C K^R[ w`# #& u&- Ջ 0@-^:0@T4T$4<$<8P 0\4 D,4<,<8 0@- @,H000C-@MPpP D000 000 0&# 9?0"0D `#U  09 `&s#Ѝk , Q O- @,M0p0P0 |00x3t#00l3 0v` 0SP ,@P, W  0 20SmVP"   ,0P e P  0ST#T\#\X PP B%, 00  B%0lP F P  0ST#T\#\X PP B%0 0  B%000V ,Ѝ0 ,%0 ,P0 00$0  00\3?$00)0H 0P<  P  !/0$ 0V4 0! P0!,0$%P (0S   30(0 0?1$0?10 N0"0 0S0ꃉ D  LTcaLTcf @- `P0S0 ! T @@#$0@3?003? 00 PЍpDNEILTcap@- P@T`P Mpp p@-P0 @0`0S0S 0R  Ѝp R 0S?  0 : +*l    D0 "P @P,   0  GNPV  A-P@P `p""!!!000O-,M { @ IT0 n302"002 0T0`S 0@$$0%@40 @20C0H> 0 00000c#0%*0>S K K[ G301!001 0$ *!'!$!$ 0^PP[ [PP!]! K! K ![!!0%:0>S 0 0PP# 04.@5: R8@ z300 000 0O"~$@$ B#0 01$  0 0H>I 00%000@$9 ,Ѝe }  (} y | @-0 00@P"`pݳ 0! ЍC- 000@" 0PP`p" V 0 P 0" Ѝs@-P@,(Po! Z(`  v# nЍpO-MP@# 0,d 04` 000 0 t0 px~l0 |vP0 n 0˃#>H0 C0SW0ppS#Y ^0@  @P 0  0 0pl30D0(0 S 00S ; $`030 0 0S @0( 0R0,  000!20D020D0#, 0 {"~ !0#" 0  # H0 C 0, 00ST0@@[  010001080孲 0%z>S0S <18p0 800 1000S9#0 00pn!#p* 0f!00H.A 0p\!#@0SS l&P`0t+ >ޱl Hb | | |  R t TIn K[ `@} P (, 00FQ lpsWhpl&h ! 0?(0S 0p0p0(R 0 P 0# 0[,4S) 0p@00l0x1p0|100100ޱ & #10\0@0;1>(04[:$0S2 0 0$200峱0S!0 00 0p@ 00S "XP( R0 " R0x "PP R0n  ? 0Pe 0; <300n+> Dg 0;"> )&0  ?㰠000S80S<0S0000D0 @GP09* *&0P 0$ 0 %: 0;0R < 0%:⸉  \ X07X0\ P )0S/91" "K~p 4080J 0嗫>[z 0.p0SxWX5080p5080۰& 0%z.Xd 0 p0S'9SG5080 0 0010010 00ST 0 0KpC4y0Pp Q R 4)")X ! R01 X280SH0.<Y+ RH0Kx uro<  6pY^S4\ 0 !!l0 (0 C2@05*X 0ϒ0 SX00!#؀YX1:WZ  hS$Puhdh$# # 0  Z  ᢏ$8000!#0 1p0 0Sx:0300S/:0(0勯:0(0兯 0 000h  [G 0 sP ߍd;0(0[x; Y 0?"9 g#2 0+S pQ!V0K>00_sp0>4;(d0 01p0S SO0 S+ Y+ Y( ho#P lh h#7 l .0S(%0So ! G- `5z◫8?@4K>">0S  tЍP P  <??@2 @0  0P 1c =%jpHN%``C`0 @@@@@$4S04^q 0  O-5JP0?`pS/[03^ S 010>尠# E0o ЍS >/Ѓ3>C?S * 1P0?0P(  ;3>VϔЀ ؀Cꀖ$0 O-DM @0000P 0 0 000S000 SR!SR -403#003 0O` QP # DЍˈa0 #a#40!a` 0#NpV` `0 0 N 280!!,0 00$00 0 S 4aᓂ#`p   ? W0SP 54_{ 0 } C GS%R]5:8_.0E\4^/PEPE000>! GUP?\0E\PE P $ 0咁"׻%<0  L 0$ ᒃ"F   @  0 <0%:0>S   $ %4%*0>S4>0C4>! %*H>0H>$00$0%:0.R 4.R H>?S|4^PE\ڰQpP 0R00v ;8 ">00C s0Pi( V?q!n c n O-@ `Mܑ5Z \.T>RZ0 00pW PkUC 0$ /1Ѝ0?S 4 0 0 dP?0峠1P00Ҭ 08 000Ƭ0   [ XpT0 0 00P 01> CP 0  0ꀖQ dO-$M @ `P 1 0 0U0V0C0.$Ѝ0 A/o"Y R Q p  )000`000b 0U p"WP000p00 000   Vi / #i Yh p@- P@Q p0O-DM`<0# P@Pz < < j P0" <0 ,R0<00S <  P< <K<0 ,RP"0<004U4"0U [Ep'0U<.Td 0,U<&Td 0Up Z2p'0U<Td 00U<Td 0`U0S"d<0\ 000` 0,0p0 04 eP 9;cp, ;`c 0`  P 0 ^ 0 S @ R 0P ^R@S@ 00 @00DЍ 0g g @~U f e 0G-@ R`H1Q @! d0@ *PU  0P 0P 0S p pBPE PU   0p0W S   Pth`oPV 8  4(  x'e e e  d jd d Nd c 0O-0 @ P尰0000 (0, @`Ppp V?Tt! `p `00T0M !!R R !  } 0! 00. !R0*V0   cb ( @H!R0 00 0 0n Ѝld d c 0A-P`@0hR"h0 0p( 0 00  &BLCK h2RG-0M `@  P pF Q 0" $Ѝ" "00FP! ЂX0P 0! P0l0/00 ?E0 QPx! X0l 00? 00 QP(! P 0P <9h63l 0P 0 0wG b ab Htb Wb 4b a STRMA-0@P 000T0`Pp 00S  0PP{FP 0rЍO-MM @ ` @p``FPU  ۍЍ0 kP W   pI | ={P> q( P` 0A- 0 `Pp000S ! Ѝ@ @P  P PP P+741l.h+@T  B 03Q^ H_ T^ .snd0 c\ BR 00/ 0-0  a^0\4 ,4<,<82300S0/0 !!#S00/A-@Pp`UPEq   BR 0F7353?0 00 0 `fPpP  VM QO-p0 0S`o0#A1S@@MTHxQ0P0100U 0P 0QЍ@0@[PD0P tD0oT@F @D_ @P` P@P 8Z 0 @ BRS 010@_V0PO-@Wpp$0( R 9P W /PW !#ppGorPpW p0S㈀00   pP    0S 00000 $ (0Q`G0 0 0 0 0S 0 S 0S00 0S0  S0000S 0S Wp00 pP 0MO-M` 0B@P0S@0@Ѝ@4P @ pP0  PPPP0 !@ J@PC-@R,Mʈ,Ѝp `P00 000P0S" ;@DPT귱O-R|M@$@(@$` yPP(00sPP800H00D000 0@00<000UpP<Zc Z{ H`X0@$XpP] p@x@ $ 0,`t0d0h`l` P  Q R S R  S  B/o"T U V W  d R6  0d00`0^ 0 Z4( P 4 RH L0@T Q CA|Ѝ8PPP $ @8$0  (0{`02`0d0Sl0p S :l00d0` 00T0 0  l c `04`0d00d0PP귱@ @ @  0-0  a^0\4 ,4<,<8230 !!#S00/p@-P@P T0@p@ T0@@- 0b# 00R 0/ p@-A\^0 @Q@A H. > > . l> G-0 M@` 1 p P000B" R0:h  0x@0(A_ @0(  B"?l 0r @Q 0 瘟010XQ00ppG+HQ 0SLG- 00  Ѝ8indx< O--(5 0@tM,00dSP%  0Xa0 1 0S tЍP0S4P$0(P Rp`x 8 0 (P800!X0<0(08 S,0S#C>P0H 1 A젛V 001:ȋ ( ( (H 000 {*R0#00 0[U  ?zI V`  T0  000f    W 0 4 ~ { x u (0 SpT0 >Phf dc ` ] PU!# $UU2 ʝ`pPEE U 0͝ຝ7 00( 簀! ?P!`"R"00X0D1\0<00 !R0ͱ0S(0 P0p(0(!02 5 / | 100` qP u m0S950S/ t h.A?>@ K< < < avih; @B+9 odmldmlh8 j8 movi^7 pstrl18 7 vids5 4 4 audsdats 4 + b4 A4 4 0 1 D 0S 0S 000n     L0H Dڝ0S 0S LD ?P0?D00L0L @D00S0L0LD0o Dl i 0 002 T0\ 0S SS P HM J 0w 4t !Ϝ0S ๜P PF P 0S 0 S0'S 0S0 00 00ㅎ 0 (ٜ, 2 080Y0S0 S 0Ps " 0 0 S 0S #  4=8;0S !uT0@ P p _0S0 !0 @P P ``P  BT0  0S0|80Sy<0Sv0&4 00l 8 h08`\/0 d TP? ` ?@00CS   ?` p0`VGGx 0u 4r T P 0i 4f c `@0 C p 0C0p&p4LE`R 0O 4BEI 0F C @ = : X8 ?›"Ί40  S00P:0PP60T& '_O-M`Tpp\ x@  0S%P R#P@0 1R 0      0000 01 08Q0S DsA\S00lRP2\0!1 P I(Ѝ1 O-M@ pTP9z20|2|"00t2 0C0(`1 @0`F00V 0_ `b`0 ^(00C@0@ (00C0 S ?01!001 00S`0SЍ01 0 ~ 0' T10Q 8L y  8? < !W 6 80Z0 00  0` @Z-? D zB'QZ00aR!2 0 0 0! /.  / s-  L/ ix0O-P p0M` @ 1QP 尰 # 0"000T0 0 00 PP0#!c(0S [0 0 $  $00S  ? 0T0 a  Z  N0` "PЍ, , O-p0\M`P@1` 0WpVQP ^\^ VXX  \Ѝ 0 ,( 0U 0 pz+ O-,M0 ` p0S 0 !P ,Ѝ3\0S ZP0S 0S @ ! P R2 R/  00Q!"-1 P0 SpP0 0{(Pg Z: 0?02"00x2 00T0 0 0 P 0XF00!  *E>0E P%  p0"0c0#00T0) /PPpW T 0Y? ?+ 0S: P$0 0 00pN $pI w!pB 0$ 0 010<P0S# kWH264k'  ) C-P `@0S!T (0S$!Ϙ# ɘ(00 S0!2 p0SL Ѝ01` 0"g!᧘ ᤘ0 00! R0`p 0   \  0(0 !0 ^0Q0:CS0T0 01 `  0p' LIST0S //& C-CMPNp0@:S$ \ P:hP,눀 +ZP00ՒP`@@ R # P1CߍD0 xP @T!T  P <  (P& & ` % w% % Q00S  @ R0/@- R 00L0H 00<0 0k0 0S Ѝ/ ЍE%  1% 0@-@0S003/P O-Mp0V, @P D0  P"0 |PPЍP"0 APP 20@0 <0@Pp00 PX @[| , p!0 PPi PWfPP.10010 0l`P" V  d0P0 000P/ TP) 0 5,PZPUP?% !P0 $5+)P00P !D0j u|h0 E0P5 0P S 0 M P@(PH $ 8$ # _ # } " -^ /%@-`Q `0 00@ 0P 0P P 002"002 0@0 0P 4P P 00H2H"00@2 00Q 0, P 0 0 "0 PЍp4Q 0, P4 0 !0 00S0`0S !0 j0`P0 PX!0 ]H00 PP,04 PP0PU- 0 5/0 P0 U0000P`V0` ;P00P00 3/! t Y! j2 1  s! ! ! }! i!  0 ^ 0 jX p@-@TP P`U 0 PU 5/P0D0 S{0< R @0S 51pC-M0@` PPCY 2T MPP:4 @?X `0 P P N10(1(!00 1 0>0 BPP0 :PPPPPPЍ0 @ R PPW x0 P P K10@0@ 0080 0h. i < &  . R i <  @- vЍ@-0#I Ѝ@-P7@-0 Pz@P 0H0S 3/@ Ѝ0WP@@7@-0P  ^@P0 W@P Ѝ00 S\0S 3/@%@@-0 :@P 0X0S%@ 3/@ЍA-PP@ @ 201!001 0kp`P2 0  @P 0LQ( PQ% TQ" W  0L03/@PG0 0f@0S 6@P 0@  0`Ѝ @%@E  # 7@-@P O20p0l 00d0 00S PU 0T03/1 Ѝ0   ! @-@P0S@yPp@- P 0PP03/@Pp@sC-8 00`pP@0P0 00e0 00]P@0P@0 0 0PPЍp0P 0S ,0S //A-PP 0S 0@T,0S p8P` 000,03/0A/% 0P 0S 40S /%/0P 0S 80S /%/P 0S //O-M$q`P@ 0 00C00T- P3 803/p 00 pUPE "0 0%;@" 0R0PTЍP UP껰߻@- 0000 Ѝ@- 0 Ѝ@- 0^^ ЍA-HMp`:PP@@ @ .$ @0 SHЍA Q/0P0 / / H0C-S@`PU ؉05/PH*R0 ı0 0CS001)t00t0"`pb Ѝ0S 3/ 0@-R@ 140 S R  BD0S @ < B3/0@0<04 0R 000@- Q Q ?PSAR 0000S0/A-p 0`vR@PpU PPU:U  PPp0000 0`V`s@-`2?@ 0!PP Ѝp0S @-@3/0P8 R  00/ G-P` @$,p 0Y ` P000SPP0PP ppW40(0pXY0 H 8 D 00" :|0?"0 x``Tp0`01L) P0*A-P`pV@P 00  0,00(000ЍQA-P[0#*`pP VP `0 0@ 0 @0P8` Ѝ0 0 0   0R/1A-Pp`V @@DT@ , 0 0 0S:`Fs@-`P( J0! Q% 8 001/P@0P0 00 1/P@0P@"P 1/Ѝp@P%@p@-P@qTT$p@p@-P@!TTtp@p@-@Pp@p@-@Pp@p@-P@qwDp@sp@-P@Antp@jO-Rd1``P\0 p @T T 00R0S@@@ 0 ?0X`SW0 V`00C##B@@D@T*W DW!6q WT7 ) {   p@-P@qDp@p@-P@Atp@p@-P`@0 p@ p@-P`@0 p@p@-P`@0 p@@ @- B@D0<3/0D0<QD<  0@0/4 0P  P/0 S// pG-p8Q@P 0 0CU0 J E`? V0 ЍTQ0S 4@Y 300 00|0 0yPP  p  X0 B`0C 0 P0@PM x. p@-@`wPP 40`SP Px`PPP40P40p p80A-S p9`PBP0UPPS 0R00000SD0Eo@SQ @R B<3/<0@00 E FS xQ 0Q00R0S 0U0  0U P  0@0x PZd0P000P0H00"` P 0"&`pfK O-Mp@80`T( 8 Q 8 800ЍO/ P4آPEP0ZÿQ 0 C03 R10R0`pV0|0S 3/P| V0 `R4 1^  0SX0\0  BR? 00 000ЍT0 P 0Y\^ 0S"R0Q WQ0 F \0X0/xX0( PU% 0# P 0 00Z  05/P00 00000 0U% Q 0 001/P0p0b0p040S000 0껰7@-P4@T @ @DOT 0 0? Ѝ0`0A-S@p` D0S A PPEUP 3 0 0 0S:p`FVp@-PQ `@ p@A-@PU 00C SAPU P`pPiUP U UU@- Ѝ@-@P 00S 000@0 0@-R@:5 0 S 2 55#p@-P@pp@-P@pp@-`P@ 0pO-S <`Pp 0S Ѝ W@  @6D Q** W 7 @ Q P3*EHo#`q7E @I\̠\`4ŵPE BQ4?€ PRT T EIR@ŵP $p@-P@xpp@-PsDppp@-PHpp@-`@P@pO-S <`Pp 0S Ѝ W@  @6D Q** W 7 @ Q P3*EHo#`6E @I\̠\`4ŵPE BQ4?€ PRT T EIR@ŵP $p@-PDpA-pBP`@pP TƷ@ P P P00 P P P 0@-@ P0q S 0CS@ O-MM@P`pp W7;740) V0#02S  @_Y W P P 00WSPXP@@PWH0S _@ۍЍ;0`tC 㻰p@-P@P0p P3 ##pSA-P0CpSP@``T 00T @SPNpP@PA-@Ps?c|0@PG-@L`pPU HXX 40S; `0S0U.D0S+  P 000UHPP PU0H00G"PE ` 0"& 0&0 00) 0R 0`PE0 0껰@-@0T跱- L\4\  00 0A-@R@0Pp`S 40S @P" ?"@ 0@T0 00@ 0@DT @ t 0T0 0H@T @P@껰0SSA-` @pP 40 PSPPEU Lw4 pRx`0`0RPPPP 0P O-4PX  Ѝ0@p`pG?PV00F [ V 0/P  0P V G `1?P PP"0P000@-0PM 0P040S t0(T 0 p0@4*Ѝ0p0(0&  t@-@00A-0pM`@W0@QP}P 1 0 0 1001000P 0^0S00S C $4N0 R4 R8 )`  /o8pQ"T  $(QL PT ,   Ѝ@ pp@-MP`P0 P,(@P@P@Ѝp@-Ѝ@-00 Ѝ-!0@-MM@PA.  0R := HۍЍ0@ Ѝ/0 p@-PA`@Tp L0S /%/@-PPU%`p @ 5/P`0p0 0000 1/P0ġ0Q% P`p ЍC-MM|`P pU  U 1+# P@@ۍЍP  RPE0: @껰@-@00!`PЍu!Q/P/H0p@-S@ 0S@@ 0R` `0pP( 00p 0@-M@`8pP 00P00 8p``Ѝ0Ps@-0 80@S`D@ @`P05 00@DЍp0S/p@-@P usp@@-@P0    s@-@P$`\Ѝp'QC-+ Ѝ PpWP) P 0 0?=C 0Cpీ0 pp("R!P:\p U `@`P@?MD @DH0p 00000!m B .0 S+G-`!@p0/ot1"S R0Pp0Y!U00!#@R/0P 00Qh R 0 @- @  p /5P 0 P# PY* P1Pc*0CP` @P\/@P P= @@X@- PH  P6 DP= 4!P( (1P0CP#*0CP /1P' 0P/ P 0P 0P / P  P BP//@/ / / / /B 21A2/P  P PP*PP;PC-@ PT0> 0 `0p000`   X0 R0` 0p`V  ? ? p hM 0  `| ЍpaktA-P @` v000pPUP p PEJ 0S  P0S200 R 00000000 h4O-0 M`@ pPH$0 0|0S ($ Ѝ4P# 3P h0S# Y# p RT0# t3P Q  hxG}zX> 0az 0+S\ 208CS !3 /p,)h&G!&0  0/&K0l"Sd  ? H   " S90      |y1 P0 00 08@!@SS ? P 0 PP 0 0 uPP ]ZTQ P 00000 ЍO-4Mp0P2@00200200GZ0S $`P F0JX! @Z4Ѝ G0S P P Pm P  ( P0( G qJZ @@ Pe P] PP |QP $Rd!0( H PPX>,012(1$ 0 0P $ 0 B R P $0P( 0 0 0 P  0 P X0\0&G (   Pw8PPRG=%# D,m yT36! 0@-M   #A R0@ !?#Ѝ0^QP\ 0A-HM @1@0hPU H ` p p5/P 0  0 !2"pHЍO-` @0SPX@0Sp7P | 0U0 01@P0S P < R$o 44XXp \JZ X0S@SOOOX4p@-X0 AXN @P$ U d  $ p\D  H5H0 S$  0H07@-P$@R 0 u$R p04S T0 00L R Ѝ0  Ȭ QP @-@.7P &`/p@-0@P P  0SpG-@ 0 /  0`/<--<P!. p<.`hU X 0 @ 0-( 0G@BS:" A-PR@ `p  RP 4S p Hu07/PЍP 00<0< 0040 0HҽnPPjIA-HM `@Pp@ 54 S@0 '5SHЍA-p @`H5  Qt  XPU!ଽP 0 0 0 X@N0 ` T @-`0S @PQ0`V 0` 0S  @ 0 5ZЍp0 00(4@s@-P `R@ ?0S P $RЍp@(PP 00D0@ 0080 0(Ѝp@Ѝp A-AM p P<@P<@ T0$?@ A `4 00 0 Aލ规 A-P p@ḁ0S@ `hLP4SP@A-P PM`P! P@p p@p$6 0 ؾ0 P| 0 -( PЍpP@@ w( 0@  c @-MM `p P ؽl0  Ͻ R : n@  ۍЍ _ς A-pP`@TX4$ B4$A!lX4@ZpC-0M0 @ -` 0P ` d iP /0 P-$ ?de cཿ0Ѝp@BA-P@Ms@p0$0(0P>0Sbl3`0V$0$u`PH D0`0ؿP $ҿPU3@00 ^0P1 "d 2V<0S& 01S0?2 0"d P!P d ,0P 40dX"0 000,0پ@Ѝ4" 5$d ὿0S21V! !vP,` 0V 0 0S" ,PP ,P , P`V 0d 8! yPCP R ,P. ,0R-!  /d  m40S 8 d00 7  6  5 3  2  1 d  V{X   4 \K8\mp4as 8mp4vH 7M  O-0 !M M(54S0<0<0S040H5S0.  ሾ >R .  ?"5S 4s - M p!ݍ ЍDT-  dE5S DT-  XE 5S DT\-  L EUN 0 4S,-  ? 0 5S (5 (5L5L5H5H544OP  00_0 08 8 D0D 44H4H402P ㉻P 庸@P 000<0@S $RH 40000ZF@KLXPM3<HNYks"<Y  4 Z7d QB #E T   J 0" !0"!0S050 !=! 0Lą$0$0H401 0!P0ͱH$ => #0QP! # W$00 $Id0  pT$0 0RS 4#0  740011SE> CP " "S00S0S "0  40011S T0S014S4S P" 0L ᘸ1S 0,", Ꮈ1SE> C৸45S !0 y 800@D@йT`pp!=(0 0 0Ĺ0 @0 $$ RD  D0S4p$p808 P0,p P0 @04@@RD0@ ^80DS:8jσq'DgL0Sj Pe H 0 Z;yuX* q.P  T 5S 0h h Ht t C  H/0@^'@0 @&0@ 00 @?۷@ 0Է50D0J>D 0 cF 1 G  A0 <40000S(50(5000 05S!  @0,EX5rzP 4tP0ES4 0 G ,"  @0 ٸ4 G040 R 040>@P|" 0  ౸? 4DP 4=P 460P0NU 0XM@ X0I40$0娸$0 #0 0ᖸ40 04sHaZvZd#vZ00 o0 R:40 RPO-@- PȰMMX00 <@ 000d0P ਸoᨂ`pVIp 4$X[" 0 I 5 O>0D0 0D< [G44 H00@0H0[E0 00? @0ppX0H0B> 0$? < Y0G\04V:8S  X0S Y D<X Ge !  ! <ލЍX$ B.7% z1 A '@ WX4@ 0B.Q/z B G G P04GL0<0B@0%P0 @$\\¿+@РH  0Х 000@ 0 AL XP0  q` h {O-MM  0P ഷ?o2(00 噷0l0(0SPX* 0S@*  ?0:0N@0@  4Kl0 ,0& OO> H0,0`,$V D=9H5 n90) ,H5 t)p # 0S]X) T 0SW <%=$ m 1 5S F0$ 0U ]`Pv d8H`(P0  P(   RX g480k,80h$80( T)0$04 Q 8Q}/0 5S )0$0 X0S X U]n 05S d 0S{ 40Sx <0LH !#0ep W0剐0 P ϴ ` ^ƴXT 0SU>0 X5S/0P$0T A0S8X%9(5Up0 PpPtP 4P \5:`5:d5 :h5;:+K+K2+SQ 0S @ 44S4P0CX$?1 A>P&`0 00 p` 000040d0 00 RX$R NH  (0SPލЍ` &RD$   P<R$ p >R  'R p"R p Vx0xP|P PZm 0XP0000`00 0S D30@n00S0,pW 40S{0,0$ dPr0 00S00S0 D0@ G0 P0L ?0  aP d 1T- 0S0 5S 0# H 0T0S 0  3P  0 R 0010`00 R:t00000 X10t040S0,0$ P0 00~& C h n 0 ^    ul _͜ a nuZE< -*2 uscA{d ]bWUe*a  L x'&< RoZ?- ?v#RgJYl} @B_ؙ z 0 Q0a1$00$ @0p@ 40]>x00 0CRV4SD!@ 20 0 SJ>0 N4 0 0 ].  4&0@0S8*1!DPU 0,0$ P  H00TPU040S-0X 05%40S&0`$P(000$0D"z+#z {:S 0(000$02"z+#z {*:1S  0SB045S :(!R 1SP30 ,(  t0$0 5S 1 0 :1S  H%SE.=B QP  0~ `0S0P  SR 40XA> #40\PB> 44 L0$00P0P0L 0RU1`P4$0 0$$0?!%0{X40BD0 QP0D A.D A.B> D0 QPP$ e<0ST D \E.=P P0t  l(MB>0ė PA0180$08040808044 R-X4P;ĕ P$! ĕ\ P480000E.=P P0  ) 0Q44 RX4d P000 VP :0 -~ 4S $P @0<7QQ0]^S |*0 ෱0@ Ჱ ,O>00 ,0 P,匱U   LQ;P00$;`000;000SD;@00P;00X;0 00SEN  (0Sx04000S1@0A6$4S+~0 @[@ 0pqQ0*JN@! ̟X0PP 0S U Q`00 R2@!!$R,*npJ1 pUP p0 , 000吀 @0S0`0 00 0 `00tQ@{ ]rPTP CHe!0.6/P !Td!SR  P hTw` Vl0$ShP5_G>j C! 0 R0$0`0l4d0`0 00 OE΄ R"ͱ "P000\00S P"A: !14S8 PR8 ?4#1>    1# "P0C>Qn C"P08$4044S  E 8$*P08444+C㬮P' +9AΈP0B$͡"ͱ 40+̱4<44$0XY T4<4x"0 <>0<4CNL"( 0 0| DP ? Dpn   0SPM 804  0P 0D0S@Q$00SP, 0SD0S ,5(%0,5S00,50 tЍ@0!4$ B0 BR R@0S1@p@QP0S 0S0S 0 00H@5S 0 00: 44R C/SڐĔ\PX 00ˌ  0Q  @B+D sidxz 0 O-!- P|M(0( @0@,0X0  X0C0( 80,0000p0Sp ጬpQ 0P 0p  J>0D  #}0 GSR  P0#F>G SR 4S R0 0!45S' `!@06&p RP p0S0SS  P [00F> SRl`X5S 0X5F SR  X0S @`%0`p 0X0S 0  @  :\j-E> CQPh40`S 80SF><D @Ĕ V0#?#$ 0$0P :1S 80T0S#!!`!h 0000p00* 1Q01$0hG>`^ 0 G΄#QP 0 0S*:^0A?o20S! Q80h3d#00\3 0k\#0 0X`\X0F`0 0 \E>`C`p 3HL0H00  `p9 A5 00 A`8P0 0! fG> C V0#= "t0S LbP 0P00T`" 0 <`PD0S 00SK #G> Cp0X0`<0\0X00 Pཬ 0$F> p0`0`<0d0`00 Pਬ80S 40SE>`0 0 !0v"R0 0 !0l"P0   ;45S < 0 C (Q ([  K0P 0 |ЍG> SRGG> A`C 0R` 0 .AΣtPI@B 0SX0S 4 $0] ,0( =0P 0 @ #1`0h0|0l0h00 ,=`pZ AV80#R0 A8`8 0! #$0* 0S44S$  0 80T0SE>`1 "0p043t0x00 ͊ 0 `p LR 0 L,( 0 p>0P 0n0*00101 `p 0 $0404S <0Sk Rh D0&P (Ȭoᨂ4S( ,00`p0=9n5G>Ѿ C 40<40 0$t!p0 NXT! 0 FD0 `!0  ! 0S   5S X0 pp 4S 4SxP( 040%,00,0( 0P P 5D E U 0 0 .A@Bv stypmsdhmsix3 N 0O-SBM@M P' $@`0G~∡ GЀ    00 X   Fn00Ѐ`X  00S 䠟Ȑp㸁 0S J4S 4S 0 P ᤫ:BލЍ@`g&4$n4S 4S  `p 0 ᇫp@BH000h Rl0P//w0p@-SH  Tp@P VpO-M`0@1pP0010 080UЍ80CYT<x!0 #d`1 00Y8T1D!0 XT6! 1 0000 C_R.0#T)  0HYT$  P  T ܪ } /+ 'ռwaK G-@Q-p`PMz@狸z相O" 0 ప$0"0 ੪# " 1 A a 힪d"  QPPTE4" $" QPcTT! |! w!0 qZe 0 @00ЍG" $  y 1 Ad a0+SoP@4T ! 0 A *60 A j0+SLͪ 〩 ?T   0 A *0 Ap j0+S)Ѝź \> zic L&Ǹf@-@-@- M ( `0   @ ݩЍЀd 030h @ X 0(@0@  0  ! Y@@@ҷxq 0@- @ 㭩T `  ঩P  Ѝ@蟩J4 z  gzzg 픩/7% C  0@- @ ㆩT `  P  Ѝ@xJ4 j  zzz{mPG `C hO-pPEM9 PP- x!0t  X`1`00 0ᖩ`P" 4 ࡩP !0@  < P  20 sP EߍB0 0  R,# 0  0 S 0 SP0 L 00 00S@a\ kb ϶* j-[ O-S-0P0_M0\ A0 @)8UpIP` `yP y_ߍ0U`P#P# !!!!d h0d h0 D0 x` 0` H Y) \0 㬨 ( 0 नW ( 0 00(0 000咨(0  ㌨8 R( <80<hWV^XS ??S 004#tpTt0( 0 p00<0080`00SWHY DX pW ppp0P`V L```000 \'0  9Y z00z :X )z0*z .W zVz +  V 0zP0: + 00 x&  00 \&  00 @&  00 $&  00 &  ܧ00  %  ԧ00@ %  ̧00 %  ħ00  %  ༧00  |%  ധ00  `%  ଧ00  D%  ध00 (%  00 %  00 $  00 $  00 $  |T $P u@ 0S |$0x  f`40\00Y 0  P \0TW%02tv5 ; S # %p#  X# P#  UV4Fp X-# 0p F X"Hpg"  0 Xڰ" 0 H X 0 |" ݦh" \" T"  ЦV<" 48( 0 !  !  ଦ V!  0㢦0y ! s!  V0Sz nL! \D! YizhO8$b| M#7 ߰ưr\PC4$ͯį6 t ][ xr8ݭح֭حѭέɭĭv yH :6<A>=;ޫs īsQCg_+xP  X  `cp 0 )   V4 0  0 00000!SR    z ! z ++zz ++zz ++ z z ++ z z + +z z + +zz ++zz ++zz ++zz ++T00P0夥}"  #V`#,"  0㓥zD"  ` z ` z ` 킥0Sp00l00h00d04 0vp0" 0 l00h00d0hAS?"  0 _80 #0 0w# ,$#  P 0            x# <#0` U@-0  Ѝ@-00  Ѝ@-00  VЍ@-00  GЍO-@-`P SRk pP`c"0s"0m"0`pg'0b< 0 \!< 0V !> QH" #Cn FSR. "  ؀F!0 :0/ !P! //` Vp!X0!0  0! 0 0l!  =C0 /0 @! ܣ,!  ףp1 0 04Sh4S 0`0 000(00040h4S0S  ೣ`0S*<ЍO3<Ѝ |J hTmw@Bv Υ F `Ep@-@ `P0Tp@P0O- P M帣 @\ p0" dQ QQ S 0\S  R  k D RA  400屣P 0S2S0S 0S 0l ; R0S 0l ; R R0SR S` ,`08`<`L0V 0W000 0<$a@`+Q [h[l[ [} [Q} 0S` dP o00 @pP @0S # P0) 0齠Ѝ # P) 0ՠP7 ȥ_ @-@2PP P} R  D< R Ѝ; R S00804 00(0 0T\F7RP@-PDM@ PPN {P@ 00000BbP cP SP0, `?`ՠ00P0 0 bpP` ` b`  R!PP# ,) ʞ103?0DЍ1 00l D< R` } R``p,l0X1@?0 /Q    2s0 R  000a`0000008 R 001s00000, `?`W00. `0 0. Ra$`!P P" RU(`dO  RH0 O-$M @@0 00`0S S 0P4 < R#800S `P0 00V*^pPFv<0S \$,0 00V <$00 $Ѝ @՟0<0 Y PUq啠3P#,0 c 0 O0,l `~80P U8P P0 6Z0      Q0 Pb0 Pc0 PbP0 cPPpY {p 0Pb 0Pc- 0Pb|2 P0cPpu WmP `Z 2`P8P000pU  0<0R,00,0e a0,0l ( p 10>++ 0W0,0l q̠W8pP8 10$0 '#0p0 $ h0D 0 0#0S 0 0R B  * R B0 00 000 S0C 0 * S 0C0000 0HQ Yp Hi$P/p@-P@0Sp\S#S   S ;0C00S \c`4 @-@_1U RA-P\p`@p 0რ@P=; 58 G-@P``0S p`̀̐p 4S  01P@4 Q  `! ,! jSYeљ@- @_ɝX0S@@}0S/Bs@-@ P00S 80SD! ǟЍp  PA 4  `)PJ0J.0 D$ D$ #P(%`0(%L%L%H%H%H$H$0V:P ⟝Pp@kP`0X0P 0lP` Mp@-` P@Md吞@P@@d@  ᱜ@ 2 0 Y@Ѝp軰A-PM` PpP  ᙜV 0008    p@@e\0S@\@@"T P @ *V ┝☛@PPЍPNp@-`h @M 0 YPP Pe@  V@ כ 0 @Ѝpp@-@T 0 0PX0@gpH0P 4?7<P (0P /&p p/Ự߰G-`PXMU@MXp 0HP' <@P &@P 0P@ @ ၛ"P0  ᧞ᢞT$XЍP,U*@P000S Q@㤡P  0Ϟ@P@ 0 0S :SJ 00D1D!00<1 0 T00 1 !001 0`P 0p0S ,@@ 0(0 N( 0 100 100000ʜ.@P\ ( 0᜜0 0.@wE1 ϔL6|| 6VO-M `倠(P 0 0] Y0(080S .pP80S(0 00S80Sb# P0PP00 'R00j( @,0S 40So \3WP =0S 0=080S00aS 01#( 80R080 ("  ๝<0S 80S0<0 PP{,0S 40Sp 2UP (@@ 00 0@ hL"0  Ꮭ00SW )SR" )#(0S3 8 S0! v u)  nuЍ~S$ #SR0 1 0p!0$  ◜"P080SJ 0SⰛꭜ#P (  7|Jꠜ   ,080@@S\PP PҚ<0S0<00\0 U l    ppPP - u U껧>ɑ͑@BO֐ 0/ 0/A- P 0Sp`@`p厛\pP创L2T AT@x2+(pO-PQ @000 p` R B   RJZ2 "A00 P *' 0 0X0껧0/0@-唛O-lMP`EP  hh pnP}`lЍ@ ŜP P `P4 X P.0*  R   R   R   R  R   R   R   \< 4 8D X 0@PHX᳚P@l Z@B0p@-pMp0@Pl# `૜0S 0BSB! p t`pЍp 0ASA P00::C?o20S70800S000꽏@- P@ 0 @0o kӘP;`Ѝَ7@-P  p"X则P(@@d Ѝ0@ {@O tP@q-tMxQ P`0: StЍ崚P0@-@ 0R >P0 S p`軰0@- R /p՛`@-@ Pʛ`@- P"P0@S `Ѝ~P걌0p@-@P(0004Po PUpdnaR0000S  @-  /J 0 /C-pTMP`&P  =  G\ =0F0 0 ` ` 0F `*P 000TЍ10O-lM0PP00 000@IT T T qT rT NTY Y@@0` p0S "0    "F T050P hp0  0T0'0p0   X0 0 y @0 4 rX $0 j0 R 00 0 ^0  XT0 PXP 1 00S < ,↗P D000H1 $@0 0!M 0tP 2$ppnP @DdT& 0 lЍYY[V0 00S < ,$0C5 A0S2 t0 T0 4{0i 0 A 6 @  pj6 uc0 @ l0S5 W0E 0 A ]K0 TdB0  H3R ` G850hAo*0 @ 30S  ) ȲP2 00200 0ȔPY 0 00 0 H00`p p 0`^H l 0`PH 8 0`BH  0`4H " 0`&H & } 07 P?| @B>{{{{{X{6{"{zzzz5 <~1zzyyyUyyqyx yxKY  u{uqucuXuNuFu>u-u ttttttttt`H H|6` 0 `' ` 0&P P &p' 0` 0p ЍO`ēPq ྒྷPk ณPe ಓP_ ଓPY ওPS ࠓPM PG PA 0P; DP5 XP/ l|P) vP# pP jP dP ^P XP RP0 0 jxpq_O-p4M@\ \00 \0S 0P@S `  0H0 000 S`pZL0I `h0lPS0C P Z0( ), (  $  0  0     ~ R0 0000sp 0 L! _  kP 0P P0`Pp R0wT 0 4Ѝ0200S$0( S :l000 000 0*봎 $  040000#  ᢳPnrf< A- @PDp `0S00Q ZW0S' 0T0p0S$0 00Ѝ010X/ ,p_0 0pt 0O-1 -@P 0li kiO-LM P`@ 00 00 0S p$p{ A%pr A(pi" )pb& *p[ت' A!pO 0 I !#0#Z0$- /0P 0^ 80 0<0&p/p  &p'p  b0p4 $HŖ᐀?00. 00 00p00s'0x's'?( 0%" 0 ? < 0"< 0 40000 ##  P0 `᝺0p0@00X7: 0㉺ 0P `@000@ 0P3000 S!* 0p 0 @0h 00@ 0$"<Ѝ01 0Ḹᵸ0 8Bp 1 0I㥸ᢸ៸᜸ifc` ᒸpWQN KH80X` 0 0SV 0CS, 0 0p0GX 0xS 1: 160 pS8Ao040QQ0S ޷۷طY?G-@P xu 000㑹`pLgd fY00CS^FJIYXAPM0^_0P0\0X0T>;ዷሷN2/㎷P)&ᅷQ |R s 03Ѝ0 K0M Q0 0/o"!gM 0UO-M`0 @P0 0pWpQ :pP"㄀ Ѝ0 1UẶ᷶/ @ 000 p͸3Wp t˃@ាᛶ  ᙹ㏶A㌶㉶Bヶ〶߶CzwֶDqnͶEheᅶ#0  5᷶ x@0 00 plѶ0 S :8 0` 0pj 0 00SRG- P@ p0`@? 0 0@1 0*P 0S 0Ѝ 1 P@O-KMP` @ (" 0 T0$ ƄKߍ40 7404 p00400x000 S)ZW  0 P 0'00000叁P L$ 0<SH00440@0 0 $P00T00D0 0X00@ ~PP 0 Pѷ0 Rp; R# l+ Q# h[# x#t P000 @Al00!0 0000 000040340J? 1R00 4B1 00C<0RY" j40.C 200<00400403,0`:00Zx 0 @e00, @ 04 P$0 0|000 00 00S@ S5 ! 3 0 S 00402  @00 400,0! 0S00S S0S40&!:pE !  400040pJ940 000pL00y080000pM0040940l : p40De00'0:0S0U0000W40640PV00 h OPNDNPPNNNNO\Ne MZM 0O-4M@1 ` @ 00ᛶ 0@ ᕶ 0@ 0S`0^ t 0bR0c 00@ 0P p R00 0 ,; ?ᲁFCᢴ0 R8OĴ唴/,  /@_T0d000Sz|@}[PQ_} x}@PY!|PP 4Ѝ0S8d00S20 C@ QR001S $00$0nQ8~^8 Sس,00,0ѳ(00(0STAij! ỳ@TP|x0|0$0/_@0  %+ !000" P000dS@@P@@mJp@- @0Sp@苁 0PS``UP5@- @P .@v@-0 @ 0=P ~ p@- @P P-P ~Pp0Zp pp@-0 P` 0P@  p~Pp0@?0SpO-@ pEM ` 0 S000 VEߍ 0PS0&   R ۗ? ~ 08 `-0,`@⹁T    ~ 80GGF"V 0 @- 0S 01O-p `IM@ P0ց0 00#! ! ! 0 Ɂ0,`q 巵0S , R  ภ幹 ,0X౹Iߍ0 噁(0  ɀ(0  00呁0,`9 jE 5ET (G-M P@偹  p{0`P쐟}䠟  m0U:dЍ01` 0S  0U0B0 t0 Y 3 ?PSDID6D'DS DO- 0SC P`` @0S ЍO@F$y 4S yP 0S _P n !;H0 XR0($S ! `4 0 0 04000 ЍC-p 000@` 0`PE$` 0߳ ЍO-0y MM`1@ 0PU(4PC(4_X! C !S1C4$ 01;  "@ 4 B"@ 4 @0KH0 @0K9/P |" 0 p ލЍԱLͱ0AɱX b ֱ 0ұUROLIF 0c埱|危噱A3 咱 叱X0A M! 000=xfro i(4U 0 ) 0%k  y44P0O440; a440@CAAAabstasrtafrtO-@ pP-0SM M⬋ 00z0:0!; 60 A ((t" 4 Bn`X"H 4 0H 0 0:/P "0  ލ Ѝ$ஷ$ષ $^| ᢷU$(! $U +S$号1P00t1000U`$$]  (! `4 ) 0D4!0Ad P  D4@$ 0$Q 00PP $Fp $A`$= } >>J>\>t>jZ>h>y>>> ?Y=VUUU==G-@p)!P0P He 6/Pi!KW W]` WJH@X4UЍ 0Pp     mdatO-Y`AM$MP 0p @ 10$0 00  0    宲! (04!0 4~ 3Pf4, C>0Ѐ X 0(4S !  4,~P0,4(4{}PP +;A>C90$(4$ (ăQ0$W* PUW 0S  W(4PCPE  RPU44|4 W}X($4 B($!} C>0 1PAލЍ#<A-M `M@P`t 0US0S p 4 0~W||P0U }ۍЍ!P0 C  ,P 4P~8|88O-P M 0a` @$$ QP<40lS 00S $4S0$!+ $40@0 0Ѝ00t0Ќ00V"  8|P$0 $4S ! P@BO- PM@ !zp ~0`S p# 4 }`ЍL P `\{P 3``000 S02#p좟`0 S  0WlЍO "0 T}\DɃ<Ĝ\0  )<p W`0W:pP J0J.pH$H$   P 0  0 /pP 0` 0?}0  8 0p 080\Ƀ8Ĝ\0  )8$!0 `g& Pc0 000 R! 4 p| 0PK<4S 0S0 |0 04p\  0! )7G"$775O-I` P D4S R P  XyP P pF& ` 0 Z CRX[ P|HX40P ` zX40X4 P pGW@4SS@4SD|P@ D$ zO0 c\ BR 00/ 0-0  a^0\4 ,4<,<82300S0/0 !!#S00/p@-@PDAp0@-PM 00OoQ@Ѝ0@-00C#A-@`pPW PV*O-PM`@pp ~ v 0W0pŅ0S0100W{p1S p0100p 0 PUU V!p`0S < 9V00S O`UЍOLP?`G-`S@ 0 @P yX`Ѝ  4PP` P` 0JSp0CQD!DL!LHT@!00 0CS` ᯬP  PN C-M `pP@P 00 0 0@P1Ѝ @O-aM`,0X04 P( @  0<\x0X00u00\0`00 ?V 0 1俟 `pv0PpS x0v0y<wy aߍ0S  84 0S R4"4<"<8S4 <᠚P<400$0$0 CR= @8(!c!r@ R䎟䞟 !Á1. Sl0 0A0z.Y08 z.Z08 z.[08 zx.\08 z08 P. zH.h08 z 00.81 z.l08 zz.m08 tz-n08 nz-o08 hz 0-81 az-r08 [z-s08 Uz-t08 Ozx-u08 Izd-v08 Czv t`x0V:  \AQ6@P3 B?R0X4Z0Y p23[*\ቫ0`0#8Ⴋ`ᩫh 0㡫lm n o 0፫s0r13u0tvv0x@S0 B0\4 ,4<,<8S0!000 0Cs0S0 !3 0@ 0P 0 v @0D+s01Sܺ0  P01H00[D TL0aD@V pp GexX 18 v 0x s@T : xzPv0ݥ M>0, \\ x0 0`Ⲑ0(0yP(0 yP0X !牐0! 0p00)0 W,  $D@ s0 S01s0Xe w[s Hx0 s0 !  T*0v0!WD@s 0S01s0 Xt=pmPP `no(0Ppp0S3*P PpD@P D@@P|`p&vpW VW~ uPz }000Yap`XcPki[PC WP 7P &KP SEP 9>P 27P LJ',P A?=; P`D@P -6S1'%#!pZp0000 L0 P0 @0SRW 000Z Yt 00000Pp `:We (0Q#  P P ppp` p`V D V D@  P`} W  X  0 S*J"WQD@}{XvtOTP iBGp`DpPV0P0V00l0! p 8000cwx0!80 000Ywx0!80 000Ow0x s P@s0 800 ;w 0!^p "^ r  ^q 0x0 0?0(x00ᯨ0x s P%s`0ᆠᠨx00   0귱0X1--- ..&.B.K.`.q.........##xp@uxuXPW Xp`0`f@V@`@-@Q00@+ PuP @$ spbvU`ڤPPuP uPx 0 v@`PPuP@u ЍtP  0 s!B!'!S!O-AMMpP Kt` Q' %Q@ 0%S@ 0 C@S R  Ps2"@0 B00C QXC>@0P`@ t0 R:t`GtP 0S0 AލЍl!A-PR@ p`  RP z1S  Hu07/PЍ]P  10<0< 0040 0 vr#PP}QG-@p R P ` 0 ` `t 0PH:/@uTW@SP lsP  tP;vFr< 0 u 1S@Ѝdp@-,@0S P`j$嗮0$ 0崩埩p@Upp@-DP@8 p@msdhstypmsixs@-` @RP 0S P *!R Rp R Ѝpᮧ@P #10D0@ 0080 0ZuqT[Ѝp@@- @  0!P ?p@-P/`rP\rP @@ sP@P  P #upns@-Pj@ R- 0s R 0s1S 0 00s!, BRds$!R L0Ѝp@sP 0((  ЍpQ9  y FO-M @MP؀ᐰ``ဢ P "uP (0 ,0 0S0D00( CC\P XPcͱp 8QR   R,H0 tH00C L0bD0Sn;0`P0P 0tW!<0  0T0TL08P0`H0d`LbtT 0P\0=! D0S  Q  B ߣJ1S' p J0P tP8(0 010080: !0S - 0ZQ lQ% \ݍЍ D [pl:0z: {qHjX`V`W(0j 9 0,00# H0H (0 QP 0SWl 0040S (0  W8: 0X09`0d0 90h090l0V0`0S (0W: 0SK BmP s!L0 tP>#| H0H `Vt`0S+ (p0S0S* [45W:  d坫:50S W :l Wh: X sPX OqP80S0VW( :  : ȟxW(: 9 00 0 "00 C`"\00`000 N 0  uP& %sjX`]0:*0`0000  UP sjX`i #"*!R 0S `F 80S0% 0s!< 0P0 0PTrT0Sl%0 rMP L80S z ]T0S% r% ` 씟줟촟 0V/:`Ǎ0VK:0L0D040`0:D QV* mD!&[0PX0G *0@ SSZTY<$ rD00D0 0   D H0嗪H0 D  瑪  卪 R  `  倪06#4 R8 R!R  P\# Jr: n( \1@o`!!Q Q@01S,Z~ T} s0H00-8#4 R8 R:H0P oP H0T!1@0!P0 @0X: h d0od0h P:0Y:` 1qⴑY :L0L0 P! > (1SD00 0 )L:(!R ,!RT :1l`H A L0P 0X0?) Z$TH@ U Z0H0 ⸁X  0 Y: Kr a^~ iPh: ]aO0{ VQO-dM Pp00@,`(000+ ~pP h<P tpP 4 P <qP(0 0Sp R 8 R* 00S:0   'n`vlP Ue#00 ` n,Ѝ Sl| Sx p Sl d S` X SPH000101w)o:-PPP (PѪ 0O-,Mz01 `0 00S ,Ѝ0M6$,PP1S40S1`0!P0 \ !P!0! $ m$ R,  00S 00  N>P1S] 0 S09#4 R8 R:0P Rk0P10{G-MM`@ !kP Q %Q0%S vS  @ kPp @jp0 R:kPFkP0S0 ۍЍ誐 O-BM Mp(P`  $jz0S R S *:X0 p{ : X@ p{ a 'T0 X0o D0S& 02000 $20 00 0lD0S/0 j j00, R6: 0$ 0Q 0P,0 kblP kP : !R:00 v 0P 0ӻ0k EkEk0Bލ Ѝ5@( ,00P: R OiBD JX@kT00 0 k$l jP ,j(0  `0s 0&,0  P ,0,# 4 uk}j`zj ,I(0  `00& (Wk,0t  P,0հ" 4 ,1,0 'hD0堰S,0` d 4iPz X[ )iPo X[*k80S 0 00j g*k0d ` 0C& '"*0X0 0R  00Sp0S   4k!  75k0S0 0*X00,0S00 0R5 R3ʠ00 *0*X p(0  $QBX 0`PЍWh 0 ji%R0  0 `00 `=.A<'O-MP5,M (@P0 D5000J>D⏢P*>jP2嘰00200200pP  ڍ,Ѝ`D*  kP g P`0p (` " ]j!0`  Vj` jP jP 5i  f P( |hP dh P   Bj4hP h P 7!  BjjP0S [ iP ,ݼ,0 00$0 ( p0 `Pp  6Pfh_8a _]Mo O-` P-(0M ?0 0K4g@0S h\ @@@@f8 D@R0~p \iP jP>00 @p:(q,qP" @pDphP< H@ whP<h hP 0p<0=0(0@ <bhPJpWN 0J 0hP8h < MhpP$8jh XhPW 0(80\=040< (88h 0*P00,- EiJ 0R?o20S , 7i kP60Q dP/4gP 4YP$hQ RP1S# 0 @D0\0)hPD% hpP e8ngP hP\ hpP RiP gJ0S Dg\g[ + 0 ;0{p hP -iP l;0)d;0&\;0#T;0 L;080S8;00(0 00;0p0<0: R 0 0 p:00:0$0D gP  0 0S P(* h\( !iP\00 $ iP\00@ iP \00* 0 kh\ hP \g @0R ) Vh hP \g @0>R |) t)0 08S= 44 @ p:00  fP *101 ,2eP  4 fP   fP gP |80$0t80,0l8000@ $fPp D, hP:D ! 0~hP  DfP  Dfo:  0:(! `hP:D ! VhP:D !p LhP:D !L BhP:D !( 8hP 0 :,! \DeD0 0 B R\ \ &  hP hP&0  P00 CR000 0 S 0 00Y 0Q PZ&0 * 1 S0[  0ǭ RW #"*Q%0 0Y|%p  Q0:1U fP 000pz1f0:!R Q0Q C $ 0 f Ѝz f00CSf0S@_f 0 D$ fz؊@zz zg G(0  $:(0 f 0000 0:00 0S0M 02$z1dP 1 %%00(0 \ez 0 z R040S0# f80 S9 0S5S S\@c0Pfk~D@" #fPg c14 0?o24Q00S0080P800pW9 : 1PM80S0z0S000(0 SeP, @pW 0P f?o2(p#t x!p !f(0#5 X! f.zc P,peP X.00$tI"6 =u wx~ `3@<!) Օ:P   IN@IcCfPDxs'2 r+ 9S{!KRF/4' eP  42f00SdP Cd: 14@P/bP, 00 zd0SDȀ\.\ḠbP  ecd! 0 Aze\0S  btd(0  !p Pe(0  !p Ge(0 ! %WV80S!  pP .b P<p#dP hPj : 1P"X.00 0D0(00%R000 00 ,!P ,dP  J.J>⌤  D4D4(5(5H5H5L5L544fdQ7 00 P00  0Wd1W):0 (0<080Sh%R0d:1S# d%R0W# dcP1$01100P0᳨P !!d P!1  !1p8 8  @@c!1 p  P !1   ]P 00Pi80DpS  < 0S*0 0 Md[J%0 K lc80S %0 b% 0 DpbDa(d[-Y 4& \H&1 0d\0 bp0  (0@  [z00z ڼ& cz00zg f}P000 00 0$ O-DM0 p,0P000x400p400h400: R(0M 82$,`0 bP, 0Sp0S 0-0 Sb-07 Mb b880S,b DЍ 80S# Z @ +P0  0$0z< 噗 b 0 9? ((0%R0(00L  O 08 6P<" 4 cc$kb \c8gb 0Sc(  ( 0  , Yj hP " ;c᳴ Z=,a000W80S4kP4 ?(8 8 Pl! cᇴ 08 P8! 4 4 $8 tP! 4 ꥐP GcP(0  B{,a aP,40S >00 00(PC>: 8Dx{}i ?YrO--p 0͠ PTM$0$ 0*080<0S#  b@`C$ ` `V0a a[`,V0 Q 0PT $#0 "*?PX!#ڵȊh ")( R 0#PX zg  zh  0!%؀SRV@`@0S V%X0ı@`40S[ V\$0$ 00C(`?o`b2YX` S %S<0RSG z0<0%狸Xz相0 A`  0 A숋  0S``V]`00000S 0 0 0 '00S`$0 0 00Z ``:`0`0 z狸Az0 A ( !+ p L   a؀%X.z z1 A a++$tI@B.^ ; ~?0H0<0P ЅL00! 0P  `P(0%R0``90 00塔(P 0(0i80S- 0S*0(MP 8`0(i<0S^`80 008 V00?(: 0Q $ V (0 8z`$:`V8 ?(ġTЍ0 0S ԎP vaP(0 00$0P0(R0V0@0D00Sp0S @`-0 _-07 _0 _D@D0S` `0 $0S #0 u_@0P  00 9 `PZd# 1 SD0` _` 1S`80S8`P _`{D  `P#  ` @0D  _8 $堔D  `@`$_D_$0S 0 B0 _P< Ј 080S %Pz( z  1 A a % 0'`P<^_'`,0S   p`P X%  C` ự  b`P<0S 80S P0  0( *00 0 ``V (+4  (0 (0<00_VP0"((R0 <  } 0(`<  q`0 00 p@-@PpP p@7,RQA-P\pP p@`ڗXX00T їV < ʗ, Aė00RPA-`p p@P஗XX00T ॗU < , A蘗00'GB=SQG- $(,pR`!G __@PxV 00 R40SkZ 0S  aY 0S  WX 0S ` MW 0S < C, G=*N9#G-@Pb043 P0UU$  "  0 `( ^Yd Z PЍG<  Y,Ѝ}ru{dg?C-P L@bЃU 0 0ޖ ЍCؖ#NO--SM倁q刡匑 Q報\PF Q@@` D0ถ0S= H \$ ᮖV 1Sp   0垖U` cH Q  @9d )[ P` Z!o 0 ^P `!0 \^TSߍH+Srp0!0 ]P 000CS  ] [< @Xh Z<+-ú 0 ;^0p >  0 1S \ 3L!. @@gnaf/S vP/A0@S 00@ Sa@P//G-Z`p@ 0R :*FP  0  RW*0T S@D0DIS Ĵ軰 1C-0M M0I@`0 :,7SPV/ :,WU+ WU(  !V_+H000 000 0p0? @  PZ@ VZ0 0 }]J007ݍ Ѝp@-P@T *0'R@@0S ] 4\]pA-000 00@000:,7S͌ЍR`0Pl p  S]n[ 庌P 崌P 完Po0QA-MMp`)!Sq ;$(,Sg b* 'R!  ,ǀP! ]?xAQ@#l!l !S eSS SX0 P Yp YWZZZZ=WPP@ EyWP @ 0 gY%$@B0P p@- P@/WPYp/p0@-MM0 P z Y@P  )Y@ڍЍ0A-@0p p:Q ?00 000 0ZW 0 ẅ`P0 P凅`P 0`0Z07ЍT e&p@-`P6ND0 X3 p@X-M0M+ 嵉ۍЍ>@S </8/4/cS(0}P///ʧ˧O-M0,Mp 0:X300P300H300(@*"PP0 8Z0 0PS,Z 4'P(7s H7S 0=C*> QP00`Pw@ 0(Z@PuLP cXYPLu0 YQ0S0Dj7S 0DP "P80 Y|P!08 YWP !0@ HP WP !@|7 YNPPXP| P P0'P0P' 8@ 0vYXP 0PP0P   +XP 08 XYP @P H  HY 5w5_KQFQBSA*< bX$}V13 + `U:H4%}`k  DWP0$70/SS0 /SH '  XU0 oRP90P DvWES0!U:D0 !U:3S @X!0 XzPPA000 R:R:R`0LP4VP PP 00lVP  J SR DVJqVP- @XPP` /V:/UP 0S !V=C:('rD7S M0!DQP 00x=VP  vXP:(7s ,VP WP=Z C0!lVP  =`0 VP DVP  $ hUP|aXPZ0$7AUPUPZ0D72  VPZ0H7(UPZ iVV $UP |P P%0 p`UP |U`7 V0P0$UU0 h 0FVhP U (TPPZ&h7 0`h0W8{UPL RVP d&0 %P~Wڍ,Ѝ @VP  9VP &0 `UU ``y00  0W@P| 0 0L0VO-MtMPN/Pp`Tq} \. @0 F@0p p0:0$0F000P$<` G00vX &T "TX_oRPU  WPP F]W0P0$<S|1$< $<#SP0$< TP000S ?SP],+0P0 V0S(P ; F p}00$<0p`00zv$0F0 ; 0`写(p0Am00`$, p av0Sf `Q0:z000 C"0*,0(W<7 S000,|0Y0SY 䙟 0 , 0   $%0S I <7SFxWu TTU D RPP1PUPGTVP U4 0T( 90000Sb aM0@3P X UXPj  40000000 0aPۍtЍ蘘 P%Q 7P 0401P 40@ D0DQ 0DS: D S!0A" A]Sr 00R 0"\P0 `Q0{AP0 "0@ 00 V@S0S ,7S pSd PP'S7S 4P 'SPS000 C0(qS00   R0uS|qSU hPTeSHP87S (& $VSPG.KSP<7S @'=SP 'R 0S@P4L7S1 =\@000OULP( gT0P40$ p080p450@0800C<080Oo@ CB$TP00SU4W@@ST Q 0 RSJQ[0PT7S R'R tR~,R XR,R @R4qp0R$80 T'7R:#  TISISX # S0 ` P #0 T<A@P@<|0 `ǎUP3 0S0 P0  UP Y a, 0Q _P zST0"ȟX00 `TP 0 `TP<TJX G RDRD0SJjRPR (>SPWcSpW @@ YS@RpۃPm<Q&,0 0 00 Am!0 F0$S04 I PP <S" A0 CSRC@'嬃P=<7SU006^6 3nY! rp2=r/ / sL-?M1 @BϬ0s@-Z`'R!.@Ѝp@8  S~@P@0@77t 8 S@P0@ 87 S@P07@@۽G-IM `@0P0 ;00 @p @pSSP1  0,jpd@0 0)s' @?9RpP40 P 0000 0⋀pP 7GS07zpPʝ 4XSIލ  O-`PpJ tRDP60!S[ 3S, D000Z0S% (!S[ 7S 3KC3!@SPYP Vʁ 6.ZP `0S YO O-MM0,00SC P@ BSP P ?P H1p@TUUP 1! YK b0000P7/6@@ X *PU@EJ7/7K@ X T3*EHo#`⎷0@[a4q=|H4?7|XPPE.|<  K%|s P=|$A-Mp 0`JP P 0@0 0%P KP   ?0P0,   0ЍITO-RM 8 P`I@Pt!0 JЍpK 0 0C0' 0pP' 0S${p0 P 0Sp0 P P " JP  0 J| 0 J I Ҁ 0P`*8  |J`$0000@0FҪ@-@vI @fJ@-@|I@mIO-dM `P @ pጐG0 0000{}0dÿS0SY- >IP@' ~YA& @0 L0C10 R @ 0H0P 0S!0 J I00 ;}V XP0#0C0$00~  B P0! I 0! 1 0000P  I@=GP  R !0P0@ 0G0h @   0G T 0p S dЍ 5 ΨO-RMЁ @pP$~` 0 0C 00 Px!@0 IЍ@X IP D IP!, fFP0S{H1 0H0 R @H LFP @ IP  IP0 @nP0004| p W2PG{  [  |50| p% F 0{00% 0yIP(50 50|0TS80 |  9CP 0 FP p1S  g0P<0 L0 0B  d`E`[$0 ]FZ2  |UP 0 H$ MF U QQ 0U`吐0 00 K0 0v`PPKR0{TS0 z \ BP@UhPt/ zh0 l0Ch0P ^|P#h0 o 0Chh0t0+Px0 #Pt0SH " l0DPxtD" E 0x DthDE0 5FPAt2UpP0t0: xPSz zp0 0Cp0p000P" nx0S 0SDx0 St0p00x0PPP ! E tDx R 0t6D0 0p10<0 0:/80S}0S 0! E 0y0S 0 " 0"P"Px`CC#90000 )$(a >+עĢlI~S/}IѠۢKpn<{H~ޚ#̙`ė0 :'6)0 #-0  0  /0@-M@P00@ Ѝ0C\/@-0  Ѝ0s@-P`0%@T@ЍpP 03/0@C@O-@TT  T Ѝ 6EPAPP> 00 ;000000\4, 4,xP4 4< <8ᜐЀ WP@=00 0S 0KC0 FCPA0 P00h @0Cl00p0t00t000@  GNPJ_C-,M((p`@0P 0?P$0 P'T0 1 BT@ 0TxC,ЍDP  DPP@@#0q000 00 茄P  CPP@G-MM @ TP D`P4#CpP0 P A0S EBPPBۍЍ 0\0A A?o2^R0S   A` nA0 BPP@ Pꈑs9 A0@S 00@ Sa@P//p@-P@tTttp@tp@-R0@P`(0@Vu00p@/ hdC-pP`,@n|P6T I0sQS V@ 0F@t R@@t V   P|(@t0S tu w| ЍA-T\@p`PAP 0S$#Ġ #̌0Ȍ R R""\ 000 ЍO-DMĄ 0@4` 00#0Sz80P0P|4,P00p40P0 0d44P08P$0 0nCPP C,00(4P00 0_CPP]  @PHp B 00C Q-SS0070  C,00 0$A00-S0000CS 000C S0-S 0 0AQ0A Qpp# B 0gA ,0 S2 009#2 00 0001P00SB L2 0  P ( (,0,CPl 8pD{P\( @  8v,00,0S087{s0 SIst 0yvr{ P>P1  B,P+ Y  R `P \P 801 0 200@0Gs,00,0C{(0 0 ,00BDЍ 80,08vB 00T00 ZP $ʏG<9 VIRPXXXT7@-@ P fssr0 00u Ѝ0@Ts0O-SM@00P0墓0 P4S, pzPD$ `4u r r4S xz0 `00ssBs uz1`0 0100[0 zA `u4 qFzPN 0Ё @ 0؁ @$ 0zA u0 r  r r r0  P z0|00prrr Xu QzX`4SЍ>COTC`PAHCO-0M @ 0S1PPp 0S  S W !0 AЍ$p0 @`SA 00V0SE`P0 @EAP4 U0KPu RPP yPquq   t yP>r0S8r_r  Pt y0PPH00 >P ` | &CIPARsC- R@`P @FdJN@T@ q 0@0@ 0@s @s@ 0sЍp@-MP`p =0  e P $%Ѝ7@-@ 0 0S  !PH0S p  H@ Ѝ0DPUL  U <  9@P Dt0꣇cW]0s@-@0`PpH?P0 0000Dsp &R\vp0P PЍp  @-<Pd识C-M`P Av@P   0ph p0 }=l0@ᬃ <P0`K& p PAЍ <P02 Dp    ? ;P;Å @-R  ?0h 00QX  p02SD   s&S$    ꪅ;P+`p@-.0$  ?+ |?$H000R  00HŔ> 0`C 0V 0S A4S 8 =L D; 0f>P" >PGލ Ѝ4S00 0 P`" 0 }P0S0" >40S "P >Q 0,0 S(00aS0J04# S0J0 S./;P00`;P0V0C?o20S 0 0 0S00='݀A-@p`WPpWP+ 30SS 0PP PU S <: 30SS 0PPPU S !:A-@M `Pp@ :0U 0)0 P d=T 0S?S@X0 ($0\0 0 0>;P 0T 0@@@:8 P0 /= @ЍPP ihO-M@pP `$ P( P% <P 0 ``<[   L:  V; [: 0 90S Ѝ 0 R0 0p@-0@ PPp0Sp0Sp  <p=~p@-0@ PPp0Sp0Sp  <p}@-@ ;;000A- `0 V0P  <Ѝ @00opP|  lml0 `00<mhmm?.mh dA-P᐀`p@W TV V @<P @V 8PP EP@0`0Cs0SRB}Y P0/0030#P0S 0 `  cQ/P  1S10/|p@-`P@PU p0Cps@-`P@p$ 08 @ <Ѝp谉p@-PQ@ qpP q@ yp ?bp pp@ppC-`TMP@gppbpZqp밐 p0 !p00100*o!8 P00; 0S TЍD!08 p;iW 0IsA 0 oPP0S p0 8`0 8P D0\<(h0$ Rʌp p l 4 8 d  w;X `nP0PQ   T \{PTyC-pt0@`0&>Ӏ  YXQlllCl,y0M 000Ѝ/ᨛ \0M 000Ѝ/| 80@-S  ;00 R 0SS  S  R L   S4S    輆A-@T0$ 0S 0 00P n 0P`pn 0! B0.*l'lP 0mЍA-P` @l 3l n\ !` 0 R0!0 p@-P0@`n#l  l0S t Spk0l4l00k00k 0kp 9AV01VP80VP90000 R @- B tn/C-0 0@0m 0P`R 0p 0PPtmkP 0lm Ѝ ` 8:̃@-@0 < 00l h00C ?o 204nЍKVAG0@-S  :0@t00 R 1:X  0:h0S4  0T0  范 pdr 0-0  a^0\4 ,4<,<823 00 @0R 0S 0/0?0 U/P< A-@Pp`UPEq   BR 0F7353?0 00 0 `fPpP  9ݢ R0@-P 0 4p1pS0t!  à  0 PP0)P}}|X0 T0 00SQ @-x4PS //l p@-P@y2Ppq2P k2P e2P _2P 3U`V2p3U<L2P (p+w:|^|3zA-PH`p@` 04@PP 9A-8Mp@0 P`TPV1PW0T0 P00 0  48Ѝ00$00zA-@Oo&@dpPAaT`F7Pqe@-` @pP0à0 P@TW@V 00x0x 00p0 03g0R R0 00<0< 0040 0 0 0 Ѝ@(zyyȋyRA-p0P`"  00@"#Ġ 0 0 0?@D℁ @D7HpdtЍ 0@A-p` 0@"#Ġ 0 q0 0?~@DQ @DPEpzdtЍ@G- 000(@f XP?P`pfP0  V 0S(P 0ЍGufЍQ7@- =0t0p 00d0 093/@P# T@D @D00 0?,  Ѝ0@6dwxw0p@-S@P PppkPps@-P@` 00? Ѝp@gp@-P`@*1 0p@O-DMp@ Pk `PU  5PR R# R R50 00fP'd]R 0R R PP5R_ 0CR8 R 0*   3`P% 2V54R 0R Q 0S  Ad$c @ܞ c c$@Ϟ c@|c!@~fT &k0H` /P0 Re L`0< #00 06o᪢0* `PMZ H4 ) xsp& @`` X# L2 L@000 10c /d`0 ဆ2rp  S`j0  #R B  |"tb 1 kDЍ R eF R| $2Qw0SYh0S+ 0S1P+e2e0P  0S RPZ.ccbPU 0e0PP10 0eP1,! 010S d0S  P 1 ` 010 S00 0dPP`1  0t10 S0Phz P\ PPouPs3rPXqqPVq@-@`pA0 00N 0Ѝ@b@-@kW10 00> 0Ѝ@bC-`MP@i0HX380pS 0 00Jd0"0x„0#P 00 0?h1S . 0G +/ 0"0 Ge40S iЍi 0@-@L1MS 0P(}5P;@?P Ѝ0PS h!000 1eC-`T0MP@* lqW'ni0HP0 00c0"0„x`0#P ?p dЍ0 0 0000Ks@-`P0@ @3à<@ 0[T 00p0l 00`0 0^0,Qba Dga0 00zc@Ѝp$l ~mO-P 0M@4 H0 00p1hp`P0H h ` d 0l S0 T00TX0 0X\00\L0$# 000?c000,0P0L0(0H0$ " 0!T0x%0 X00\00000/0S0SG 0480S R4"4<"<8S5h `OpWn4S0S( 0480S R4"4<"<8S0h 0` Sd0h `M0$Sh /P0T04 p# 0 0/Ѝ T<pP0 J S0S0  0p  0 0 0S 0S0  p  -렀JZʐ0h`00Sh0S0Ch00d0l !-P l0 S0p0x02l |0x0p0t  .`pl -P l R ;QP Bl  0l00l0S00S 0  0404  h0  ?0L 0 0bH0P80C`40PS `d0`h  c`0S ~-40 SR"R 0%#"0  0l0S `p%`R `M$8l0 00*U00)PlpWppW 0p0(D0p-0`0<`p]kPjʚ;O-pS0LM`(`SPp0 @0  s#8  0 #X '%@0@刱0#  0  .@PW 000"Z?PLЍP `n-P$9 -+ P0  {g0P $_ R 0 0 '$ 5 0S  z. *@00#$,- R aB\ B  pO-|M0$80<0R0 @$00@0\3D0P|ЍPqW0QG 0S Z80!PP0 8H %d0S` 0 8JT1S(`<`200020404S P0xPp0@5$\Pp pL2$PP4<0S  p< 2$|P 4@Q!! ,!" ,!P00ᡏ ! Q |! -V f8f{0 8X  80!8 080 0 -P 0 8h  8W4 8|Sp080&`080%Vpp P ! 0 3 00 PPʚ;S\|pCgTbO-,MPpP`'@PJ`P0W,ЍZ Pxp0pUP0P P PP0 Ї000 `J%P`P0- cP 0 0/o& b! G> 00!`tMO-MP8B` lV<@  0 > RQ `p h`,0 00 K 0 `0 @,P=0< @,P9  R. <2S 0000@  00S60S# -0"Q- s@0[0<000 !Pߍ nTL- Q 0 ,=R000 - ! P0S> <"`V 0@!P?o20S, "0S S S0 L100DpW#H`V 0HH`Lp P  ?% 0ex!R+ +0pW ڨ`V0PP`Tp P[0|;00&_P `;00_0P S C+SR}(+ 00 0 X 0%"`00 40?4 ?@`V :V!0j`0 @+0P) +0P" HrP=p`x 0p 0W V  V  V  0`p *)0 0+P p 0WpW 0G0  S R P0S񏐽 *pp` p``p``   ``p `p `p``  ppp` ` ``p `p v0P @J+P% )P!  0d080S 0^ 00 $0?0 <0 00? ?'P0' 0 +P )P0!SWVYX0 0S 0S\   ?ߘ 04? 0 S0!.0"0p`0 `Q```[L 0R0R0S 0P 0R0R0S 0H 0R0R0S 0D 0BS0T 0BSxD(D `# ?x # ? qpP ` 0 0 qpPc `0n x %P0S? zz zz zz zz z z z z z z zz T0S z`z  z 'o0 00]0P Q/ p`P 0S@\# )400"P0SF 2RBp&DT&0 R4 Q00# $0 ")D!? H!? 0WV 0ߕ ?0S  0C  p&0SK :S/ 30 2"002 0l)% 0q0S : s0S : t 0S : u(0 q0D103?H103?L103?P103?T10Q/r 0 q0D1H1 03?L1 0x`\9  R60+ D1t0 H1Q?0 V(P0 x  a P[W9xL"`l x]ʚ;#\\X]X4Y5YY$.T\PDbt 000 %0H0z ]Q :P xP@NNMNOO-dM P@6`00Xh0 _(0PL X(P 0p, 0S0# i%]*>-0z 0pc 0^ 0Y 0T0  ?J 0E800#gPX Xp 0Z 0ppZoZP`0$0 'P  H4k x 0'AP  0S 0-t (yP>Ϡ" 0 !u` 0ba_0 &Zl1Se 'P5 P000Xg:p#0 M'50P#00S 0  @'0P   @'P p) - A) @&P$R 0" 'ФC>P0;L"0 /0)$ᄔ AD" 0&02 8P `0H!R9PdЍ0 0 @,'P  c&P%Z~Z0P!0  /0#C A|H! 0T0 oZ P|1S0  p0AA S=\ 00P 000$00S 0S00pP0WF:t0  P p0S! `@`H1S @Z P,T100\10 00Vk:0 0 0 001P0 `Tpp l1S@pp 0T110 0P1000Y:H1S(0ST0 l1S$5S X1S T0 l1S 0 0 0XX1S0X1 Xw "0 10$T0\ lP R00# \6\10q00SKh0 @P00 !0 @%P  ~@0  @%P#0 ~% n@yP 603#003 0j%! @`f \@0 O P0@&# X0@0%`< 0 0( 0PXW0 00S7 Wh/ P0ᓩ* 3( 00@PAW% (0P" ' " 000FXX00%H00$@P0S(pƓ 0W*000S ph0@00P P 7# 0 @AP6 (P0 0 0W  PS 0$5$z0X1 R00/ \9\1 0O-M1P @`0p尰P0h @$0SDQPT& $Ѝ@0$$SR %X p0SR P% w$$SR"Z@LP0 00W#0R40 0@$P0T 4% N$@0 00 rW0SB D0 0PX 0T0 l1S0S L1S@00S#R0(  P؄$P (0У #PX#! 0"@ 00 3R P0 h p0 S"00L0!0PD0 0# D  0"!0PH0l30H0l0h   %!%#& 0V,0(0$"&!% % 0" 0# 0  à̌0   p?     ?0 0 0L0P CU  T0 h 000H00l00D0[# x0 0'0p0T0" l1S#R0(  P؄H#PA (0У #PX#! ?"# ?P@P@0@0 0 0 à̌0   p? $R 00p0  ? yx0 0'_BBA xFF:>O- @-1S\M =`P '0 "\Ѝ$SRN`PT`` l[`0 0 0UPU X1SFXZ `P0<h,080000(0p[`PtP(0pW'Wj <"0P (P P`(0 S00Ӣ? C20@6<&0006 0"0 0@0 06R`P꒓ 0ꖒ#Q ,! R% 40 @0( < 40< 0!<!<"SR <H0<0$(PW@< [< H`V0 <P[V8L[T QP 0@ &< [~XY 0 008PTU 0à̌0 a0`X1aWVZ4$ P "#a! V0S`R!  R0&UP0` #P 0!  `P0Sa0S|(0S P˛L3 0(00 S`# `T`` `( 3 `P0 0`!T P/ TP0 8!Z!`X!?SR!0P (8\2 b`PXQ a?WV*0 ABP{P 0 T Pr&0`p ! w!%`T A&`` `1 .`Pv`" `T`` `X1 `Psfh0P`;&#R090p 1z0:  @p0 AD (!0 0 1!#p(XTI{H z!@v<`q<㦍0@`( +!0 (8 N@K<4F;uC(988gTkS7fIkTO-Q$MP @d0 WV` `P `0`T% 0 $Ѝ P 0` 1p$000h0:* `"5 R0$ R RS0  R S0 0mY`P >kY0H`VPd YSk  Rh [`"  \`P0S00T`P  `$`S`0 @`0 00SQQ &"S  z $SR` P0eh 0Sg `Ppؤ0 00@oSpaV\ Y Y> R 0`b0S0S" + `ES P  S l" 0  $ `?S`0  0 0$1S0  YT`P  RSa S !0 0  `Rp\1PF> R 0A0Y00 PP8$0 0Сp1  !0  0S0 L1YS000 0S1S|`V 0 0S` `PY0S `4P P*1e1@B/PQO-PP а@p `P* 0 PPe00 ЍW V0  Q >P0S 3P4A-@ ` pP0SP4S Ph4S0 P@4 P l4 Pp@-Px`@ `+WP0 P S S Pp 0W110A-@0PD`Hp0S0^ S |   0S 0S L R  R O0 @b#11 00@-SCMP@ L  !@ ,   RCߍ004 @-@R? @cb0C- 000@Q X0``PpQEO` 0Q ЍH4G- P `@ 00 l0S } S S "S D S D" YЍ( 4s "0 ph0S00 0OO?O ЍOЍ/Z000`p Z0V0NPZ005O<8N5P00S4$XX: $00(,SS2$  0pN00C04P#R004S 0]NN0 00 M444$ QQ$$ 300 0"#SR  0 R 0NP 0"@` p 0``b (Z"8!# X#(0 #0" Z0 0#PP0b#0 R 000 V 00S  Z0M00C0?b" Z0P00 #a^ ^`VoTTXXh DXQ ,\,Qr MP0S) 0S& T0T0 0H40S: c" 0`pj20H40Sc" 0`pOJWV 0cEL"`Vp 0R`p000 v0 00  0*Lc" 0`p``0 00L8000 6/P00C0T``#freerootmoovtrak-#hoovcmovmvhdZ"!Ю ilstudtametakeysdtrMO-0  0S%c1C WV@ V@0PMGM0 00K0[ W V 80 G ЍOЍ/0S 0S `  0 LP0 00R0$ Q  fielhvcCdvh1Ms@-P@` U \  a"LЍp@Ѝ/ 0 P007M@-@ 0x00 0x0Ѝ@Ѝ/MO-0p⤰ `C T0LPL@TP P0 00DK,0 ЍOЍ/hdlrC-M`8@ PT0T0 Ӏ0 0 0KYX 8! $ЍT 0p*T 0@T0  YX @W!*0S0000000c0 dP'LP @ 0@J,  8rootA-p@`g PP00S  1C1 PT5PS 0T5 ^ 0S, 0R0 ,00P5S cP, P5S Y0TT5SA-PM@p\LZLT@p`x 0 Y  <00<00 ЍALpP  0 @rmMA-  0SЍAЍ/ 1CPAq"* R0SR@PKPL OM0 `48 0  "SX T  "0  KP  귱MG-P@ VKNL`K0Pt x?ppSB  \P! /S- , K K` Kd  K h0 K0 8l0 _P 1"GЍ/ @ ĀD0RR0"Q0 0귱oMA-P` 0Q D0 V# D! ^ 0`K` p` 0QsJ@KT VK`@ P`@dDAЍ/MG-$  0S7  1CP1 @JKc8 0`Vp 0C`$0S  $0 0P$  00S $wJX0 ЍGЍ/$MG-PM@l` _JpVKqJnJ P 0pt!8 0  f!8 0$0S1U0 0@> 0 1Cqp1U0  `1U0  P1U0*  <1qpP `t P 0 a0!0pMO-$?B? X0!$0S` `&PX1#QP" 04Sl"0  Tr 04xP&1#QP 0 " P U L0S 0! LvP  PL p 08!b 0P0C 10(0!R000[00SP,0>,00>! R00S$ LR`>>! R0!>! Rg 8 `{ z 0(  R Q 8 0A l >bMO-P$p $0S\! g OЍ/ 0S  1C(1 `=>h>P 0S  J @@dP  0Y0YI>넱@X00@S d  & TP0Y H8>넑@X 00S 4stcoYco64MA-  0S bV 1C@P 0g=`Vp `P/ЍAЍ/M7@- 0S@  1CP !00 0 @P   Ѝ0@Ѝ/'MA-Ԁ 0P, 0@P AO`P ! =/>0P 4 Pv0 0 r &0hh0pS00W0S000 !AЍ/ @MG- M<` `0P3 0@p AOPP ( = p PХPY 0 1 d0h0 0 QXr &Q000 ! ЍGЍ/ @MO-$MD@  Pp0S% `C0P >P/ XP  QP  JP !0 t ;PpG  OP   >$ЍOЍ/==y< 8 p0p00x000 P `< 8 C00T  D PxyPw0xH 8H LPpwpPpx]<~^mMMЍ u.MO-M@@T  dAD0WVP :B0C02RY 0 ;Od V0fV000R00S"  09@PQ< V0!Y? QP 0 YRYR00S  0;<0` 감@Tad@ 0S @ $   l@c @@0 0 a   0  0 q= V0;ЍOЍ/ 0 @;@ amrf2PPMO-4MT  0S 4ЍOЍ/ 1CPp1 00 <<4 @RԴ0 Pu? P00@@d0l @0P 0 @弐T40,0 0Y 0l@0;0 00`9 P0 X!I;;X0  S R 0 ; ; pP010#0 0 07=P0`#00( 00 0 0:;? p?P@1?@#=Po0"0( @ 0j 0:p;m;"60 pX0 :20$0|20(00 00s9!P0u:PJ;pG;, 00p@@3@t@Z=%PS  <P)0T  CP0 @Dt@ 0T0( 00 D00SS t@/X0 R:R@Zu P  <P0/ X0$ :Q  0@:z00!8 00 0P 0I  00C 0(^alissM@-P` :@:0S  1C<0S8 R P8 T `  80Ѝp@Ѝ/P /0< 8 ?_O-DM1@ !1pP80<00SDЍ0 0S$ 1[ `㈡ x 040? 0d!k 0 80< CUE 0T  P0<@ S! R0SR ! R0" 0 0QPР P 0,0ء? 0$0" "0#R L0P000 P 00S 804P!!@BO-#Mv MP@W,6S/`HP`0 0  G0@X/QSpGS /0H0C Y} p䢟#=0 04I6Y0$(0눐Y  P 0 0,0HE4/P#ݍ Ѝ$ 0<0@@00 0DD0 40q<0`0?H$0H0 0 =G000  0p@ 0/G0SE P" P$PP04P  P $P@0< R 0 0S  50,00HU 5/P 0 $T(0p PJ: .PE6S00x0S=4 /SR\7@0</MO-`-ML $ C0 0SЍOЍ/ 1CA0s Pd8p[900W08888W}8(888888 p88 8$Xp880`C80@802 000L00(000F000 0 p0 $0 0!pp$0W00 Y `$VL0S\0Sl0SP0ST0S X0S`0Sd0Sh0S2 Re$zP$L0 be8c8ya8aa R 0$S @ j !@  8 @ 0 F0 @0 SR5 $UU2 zz @ @ #  ዴZ Z  ` p 8 $ v@pA{Gz?jEO-Ā@`pPP0  WV  ""1PP00 P  0 R0U " 0C@K 0 `00000^$P'0 CCCC 귱MO-DM@d 0 005g7pPU0 x770  S" 0 i \ 0` pU3n7j7`pP]7[70,080000400U%0 O>0D5g3WVPp@ `0R>T`a00B7>7`p17.70S(ZP!70<0,000 L0  4P" 0`(0p0T,  0S*.؀YX A p0 PD5S xO^x ? ?` V 0060800P0[4 0  DЍOЍ/MO-4M@`TP 0V@050S2T0 #( 2 04 X`04P06`00 4P0#` pV# (i0 004" P8Y%c`0T0 4ЍOЍ/[6pP?X0T" 0<` g?`4P0D6W" >62P! !(  000E4+6(61P!( 566 66[2(0[1,0$$0Z00! 04a5pP50S&650  P !SRP5(0XI5,0X W550p758`14  AQ.arfm1arftMO-M`CPq 1 000L@P `; pP `2 0h 068 6 6@0 06"  Ăo`0 0`fV"  _W |"` WЍOЍ/ [ @" H`X "    t   , a  }T000 `P 4! $a0  pG00 00  Q  0S*p 0 S0 0S   4 0  ,gSO RO-` Ppl0S04&?040(0S@tp`0VqF Ѝ01 @TB 00S>0张SP8ht}{$yHwLu sRpn5S*QhQeUPjH4R[R XSUSR`0I0D55X(@7,0S(2 0p 0@,@ 0W`#{pO0@p@-@PDApMO-4MT  0S4ЍOЍ/ 1CPp1 @u3m4X 2R!3\0 `S\`3\"8 \0Yd0F0 0F0 "0 E4I3`X jX*h0S ! h:d Ph  ⢱@Ph @5P h 8! $1!R 00( ! N.00$0,0 00Q"h0V 0 V    0h \ h0| 0 K  Xd 00SQ 4  L$Kstszn6@- @` R0Q@PIA40@-0CQ8 0 *3#0 0C !! Ѝ0\0 0C:0$0 000 0QpO-4M P R0 `0S 0,0D5@S00 00p(00GS)0O 4# Rq@ 0@PX00!.!8 " @0T1S 1 P0B000 0$0 W 0S $0  0S$00$0 ,Rؠ[Z ! R 000 W00S0 @p0<  401!001 0xؠ[ZС[Zء[Z0( @T!ñ*Ʊ0SC ! RAT0X:?`QP ?01 000 0PU- ?\0`L#.B BS -S _"+B BS $+(/SA L-S D-S + S &BSi@P`(S o*B.B BSX@hP`(S ( ,Sh@P`(S 1"&+S (B*B BS ~+,S &B+BS@h@P`0(S +B/B BSX@ hP`(S~ ,Sg@P`'S  (B,B BS ,B BSug@P`~'S ~+,Sig@P`rp'Sb $' S[Pg@P`d@'SO B'E+,SN$g@P`W@TG g@P`Of@P`JV@fP`Df@`@@fV`P:f@`6@fV`P0@fV`P*f@`&@fV`P @pfpV`P1S@T`.PU00S0.0`崀00 @9e@`Q8@U% }뤥r 08`-.@ELPp%d0 /@TX% 0 -0D S ,% X@h. e. b.$ Ȋ 皸zh'(') Ȋ R@ ɚ$ $0 80S pP 0@ ! C9G-P @P t! l1 R ;C\!/>CXXPD! 0P5S V 0 +R !!TP W冑! 00*0p0S 0$ 0 `V00 S S t  ) 0 Rz  vꖨ?6cnec1cbc3}M@-P`  P@ 0 R !0 @ Ѝ@Ѝ/ @T X! HA)*: )p)0P5S" 0W  0~P@() 0S  @P   0 R ;Cx />CWWP`  0P5S0 R  _@٦զAcnec1cbc>MO-$MPDp`  `P@0@T 4!0 $5()0 0.).p`0 &X  !&3R !!`0P    01  0 R x  lADAt $ЍOЍ/Y@T0@ @Dǥ3M0@-M@ "RЍ0@Ѝ/R  *P0S0S, pP0s00SG-H@P@_ UTpp SRpW ` Pp@@D@跱O-00ЍAЍ/0RR:00R0S# P0 0&X'U'PX`@@M'P P vʆ` 0 1C1簂b(0 AVinAVd1AVj2M@-@ 00"  P 0S  1C1 0'S 2?402?00Ѝ@Ѝ/MA-P@ 0t 0SR,P@ pZP0t00`C>ppt0 t Z&R'&P&&& &AЍ/ O-EMP, 0@S Eߍ00 S4 R \! P,HD `1SD$#DL#LHTx0Gt BtTDr @D ]0 t 0 ] < t ] 08V$8r 0 0   x ` V`,PX%P0 껜cy|֛G-@P0 0 R0t0 @Pl`0d T_UTF D 0 G"0 0G %|Oڃ@B֋MA-@P %&XZ &p`&0   &P0@! 00(!80 X>% R p0S? 0 0C>$`%% 09% P%% %$U%%%%%%%ЍAЍ/%`p%%9F@BMO-M< 000PU  QE@`q xPU H!@Q ЍOЍ/%P Qr%X.% %0@ 0 0t%P0xʠ  W0x0Xm%` $X%P T0 L%R% PN%L%Ϙ6MA-M@,`T HPP   m&PЍAЍ/0000000 00P@T0D@ qᰀl尀l0SD! 0 r0b0C S 0 0 000ᰀz v 00R 0lX <@ X; X; X:0Tt0d  ` @ @0< +h귱ז MO-,MLP$P  0S`,ЍOЍ/ 1Cp@1 $%$!8 00C~Y .yk000,0! 0P0 ` 00t100h100`1000`Vo$l$0[P 8P0 S0`$0V(01  `A $P 0 86?%?CS Y  +3(` YUU1 Q0PeS0P8 80 u `sP(ASDO-\M `@ZP@pP`V5 0`!0'' 0SpЍ0Xq p$V!  00  0`01 00吠S 0t`0S`7P 0 0U0W p귱O-M`p P `@=`0 1 < - 0<0<Ѝ0$0T0@ 1& h0S 0! Ph, _## !\ZY 0 "R!0 0N.x`? "GZ0/ 1>(01,0"R0d# ` "$ 1ᰰ>## !&ZY 0 0Q.BP xN.`? "Z0/ 1>00140#R0"` P00q0Z ZԫP^ `$%R $02PR$(%R 02PH(,%R 05x2P>,4%R X0n2P448%R <5d2P*8 p0 000 R !004010P01X  ㈱  RD "ơ"ɱ! P0P ] 1!00  QP t 0 Kroot.w[tmcd@Bn ΏrtmdPP5oMO-MP8 @0S0  % aDpW7 0S$D0 J < P (0S,0<00<0-,0X020x4t$00h4 0{H0С[Z4 0S&8$0 $8%$d0 $ ?? QP#3  0C(0(0S6?S 1 # 0 H0ШQP 1 P\#  H0QP <# P  O$# P O>Ш# P !p(0 P ЍOЍ/!(0 ,0!P , 0 B!,0R,(0 B! ,0( 0 B!0, S( 00( 1,p01(0H0S, ( ,0S!0, 1ӓ!#!C'% ?%0@0l0100100@0( S 800Y_ H0S (H 0"(0@ S(0@ C!0 B ! ( 0 B!10C1(00C(00WC@0吀(0W !0Ìӓ'#CW<0DSp800P d  T_ 㩪 )hqXhG  "׃o|h0`0@0SL0ld d0x0 8xL0  8`L0  8L0;h0h0P0 80PP0P0SP01 1 0cR 0#SR R̿h0Sw P0Zh00 0(!P00# y00Sf `1l' R@ 0000,000 0p`10000008!P00`0 0%p "0 B0xN΄` l0 0؅ 0% Ѓ 0 Q΄ LPP  @P 0 L@0 0@01#(Z  P00pS  00  <|P (0S( 0(0<00<0<0S%%(ON 0 BT"Ʊ^ @` 0QsĠА00<0<0 S0,<0l08d0K8CL8 $L08 (( 0$"(00QPL0 8L0 8d0|0r0PH0 QP Ш P 1#H0ShMO-_MN` ,pP _ߍOЍ/PXPs0P,0 0 0 00$0j? P,0$P0S ,00S, 4 R , 840^,0 R 0S ,040S ,0\0S,0d0S .0 ;,0d0S,040S , 8# 0R*x.0 $d,0x0S ,0H.0 0, S0x0,0 @x0+ @P(0P0`H0[ P 0##L0Q@05 S R/@0 #QU 0Sh- # 00 P#0 x ?#P 0(Q r0U#04 00 0@?oR20S004 0#00S0S00S6 4S 5000p0S t00S0D0S H0000d0Q$ QX<QUPP0 b00PQd V101 .r (P!,P P0,0, 0 CQ*l@, l0D@@0S $!R  0, $PP6*0 60 0 0(0000000/ 0S980S00S 4 R ,Q ,P RS * 8 : +`  ` ,00S S,000S ,0x 0?0 R 9 R,00S "R0,0x l0R00,0,0h,0t,0,0H,0L,0 Q R#͡PU 0S  0#, (0@000P0H0S ( d0R*0 @P00b1X*( d0R:P#`0P` R`?#0 #%7`0`H``p`x`0gH  ` R`05 # 51#11 0 1&H0 1 $400C S 8`P $R0\0S ` S*8 0+# ,)01#0$P)P0& 0 3\0`0`0S \ S*& &\0`0 0 0000h60008 0h00 0Z:h00`0H00H R:"R x\XP ,TT0S00$0S! 1 Ph01䀍耍000쀍(`80000L0S P0PS PKD% ! S R00S1S ڈ1 0Q  ?! ` 00S0X RG0^D  RA!X8X 0X 0Q( 8Q: 0 ,$X0 )$d0hS$ {lQp\ tp0 0^ p0p0\0pS=0㈀#DX5 H0 0\.0 X P* PQ `\0V`PS㤀`PUhhQq   BQDu"0 )00Q XQ H 0 !  !   00!8$P h0 0000S1cS#/0x0Q000S  x 00  B  0 & 0# 0 ##R0#  0# 0#000 00x00S* Qx000}& R0# 0#||ky{P-~Pwuuuu,w&sqto (omgm.mlolmmm9j#jqihgxg_gP fcXc R 40`H00CP00X0H0X? 08 P00CS bP011H 0100P00X?* 1 40H 0CS  80HSH80 H 2#0@0@0S1 08000@0PP0X Q QPQ! [  [   PAPP0X00 @05X0% 5 C  A0`&PU"0S00h |U O@0P01X0O0000X0P1V "0 @0 SP1\0[#000 r0#  !  001000008P0#! 0 P 00 0 0#@00Ci0@000 11100(0T0X0,00(0Sic $  0k 0h# `00*)$0 00&)l400P0` R 0L ʿ 0NB( R R0(PQ 0 %` +00SY)!)P"P 0"1h48 0!!0 )<ꐀ唀00SХ r`d0ax% R?hؠZ0H0000耍*`` 80 hP&& `&0 H0`000*h 80 P & &0 0/..h 0`&&.(0 000%X00\000S0HS'͑ R0'0S000ÿ80S . R8!$ ʿ '0 } 0$. 0.80+S R+0, (0000L-0 QP08 !  8 !0Rt(0 0I}. 00000($R0 0 0P00 RBХ$ R) 000Q00S5 $ 0Z0 00R00S' P0H C1 01$ R?$%0 0S 0 $$0 0)  0%20000/ $ 8* %0 000僡 rPt* `'  @0 RQ :R1p 01 0`ءH01VaR0S !;Q, + (R$ 0 ̿%00S 0 $,  R 0(P 010q 0Ф001000 0 S SR 0000%SR' 0$$ 0$'$R0<0`0`V580S ]80SZ 0 00#R00S$0T (80!0, 000@00 QPD80Ш100. R 0 0-0 ``Px `&? 0!%0 & 0 0&$ 0,P0T 0s00` `' 0),$u00,(P000008 RAP@P^O∡0A A$@ @PHJ@X@X@TX@XP@@ T8800^OX∁CHHD^OHAD T @DHA @@ PHH@& & (   0 /0 90, 00004 Rs dd0ARRr ' 00Q0Q0,$0S\ &PXAVinaivxO-4M P00`7 00 *pP  R X4Ѝ P0 @00!*0 Ѐ0 P 0R!P ŸP 00100400Sk 00 " QP x&0 `6X\ZP040 S 0 &00  B!P 5X ;P4S +VP  00S0S0S0Q4!4<!<8qEQB @  Q= ; S: 00؀ 0$00$0^~ T(0\z*1 0ÿ ? X0!0X0R0TX0400S2 $0S R0$ SR!R000$0$08 Y$# 4037Y 4;4+XX (B00X00S 0p$R* PX * " R0P 0)505 00!R0! |* p Ѝh:X` XXH 0p0(0(0h0(0(08) 0h0{ 0(0(08) l800 0g80S X pSP 5Y?o20S Y4eb`];sR@5S 0SR 20 RMRa*BQd0P h l0\S( uY&.ᰀ30 A{z%h"ᰀ 밀8 RY1  rY00:CS00SR+  Rh@ " xR$ R  !  RH' Q Q$$ǟ R   Q h  h X0 00$h  ! X0! R 00 p6R p0  00 4 1!Ё P0X&0S}?YX0 PX00 0S$## 00S$##D \4 $,4<,<8H0L0P  Z*$ ,*,^ (.$,. DH0PL0X0 R4"4<"<$8S0S$#$,#,0( 0R 0ắz0S  X?01P 0 e0 00S00 @ 0fP` E 0H0 ĠS 0@000 (0'  8 ! (0l# 0X%h  0 00 P0"ᰠ0ᰠ4 0 P1# #Z  j0h0S \0h @"H hP0," 0  0 4  4 尀 2 R hP00q0 0"0 P 00 0040 00w! P0P P 0K$a80 PYy 0 Ru  5@J 0 5P2 0 z %0  ]' =L5\\stsd\AV1xapchdvpp[Zapcnjpeg4aZ,Z2raw Klpcmtwos P P   mp4stmcdeman{TMS9RI420H263QMO-,  0S`# 1CQ @] TP #po``pডᇮDZ Z0  0" b ЍOЍ/5S 0" P ` }P Y`P 5`  P @0 P %5  0Sl0Sx0Sl00S# S0#0%*S FS S S00S AS|0p0y S? hS0h0=ql0oLSAS*ASAS* !SS]0$SZ 0h Q4!4<!<8S S #ASF0h00`Q}=l0V00#00^ 70h0}= `5SP QQNP5UOOP PPP(PQclpP PQ#1/p0, S 01 PQ /ȶG-p0` P 0(QV 0YX00P00S`0Q  0,@T d0@D0 P\ |0SP \ WV ꀶO-Md V07@X!08 P  0SRV0 WV X3S `0d V0 0Q   aЍ 0nPk   `VpX0 U UPEU &U 'UQ P@R04UT0@-S Ѝ 1C`@Pq8 0S 0S # 0-0  a^0\4 ,4<,<8230 S/L,30 S-SÀ^\@ P0 @o/@-0P0P0 5";>.0/ 0% O-p00M`<,!P1 `CA QP @TPRR[Z Q   @PA#SR P  xЍ QP @^A@P@PTTA-@Pp`UPEq   BR 0F7353?0 00 0 `fPpP  D]A-@ p`0P0CS  D 0e60 00 0`P  & 0\ 00S 0S0/0?0( (S  /PTG- @0S 0 ##PP %000 P耟`䐟u0V0G0H0S#?0`0S0C000pP =00X0S \0`]U= S0S Prtp tmcdD0A-@pM0 LPP`P`P H008 P0 D000D`HP`PЍzQ@-pM0@P`!P0Ѝ@-  P z  +{  ЍG-@rbR GC-@P 000l  0`pd F 0\ V Ѝp@-P`2@6-@Tp@'A-P@`p PyJQAQ0@  ÀP @0R  B"200C@- @O=I nmhdp@-@XP@.X \ XpglblG-p0 00@` (W2 10P0 00 0Q0 00  0`p  0 ?Ѝ800`03,0 P 'NVM@-0? ЍO-M 000@P X0X `p  DQ P0*ARl =Rkʜ10 0 ;P0  R 0S0  LP  0Q$!  Q,Π , dDY(  QQ1gdX R X \   0Ѝ`P0!R @ esds\O-4M p0`0 0PW 0Sg 䢟 P 0S S S`H0"Q "S #, S bB`@LP 0 @P 0 0 0P@0S@B@0  W 0Sr s W 0S d 0 4Ѝd 0X!S5 P!S7 ( 0/. S6 @  0A@! 0`3``@`@`@`@`@`@`@`@z`@`@u`@`@p`@`@k`@`@f`@匠`@ qLFc608tx3g~IA hdlrHrtp tmcdHHtHHHHHMHNHSHGGGM^GhGTnGGGG@-MpMP@`/P#  PPPPPp0 D0 `p`'T!@,  ۍЍ%Gudtahntisdp O-LM,00 00d380$( <00S80D0D PLЍ$00[ 0SD 000S(0 0[?0S$0U, 00R;%0?o20SD@` `0P `'؀N( ( R0!,0X0 00! 0!(p:9D 00 00I 0,PZڗ L(0L ܀  ?YX < L1:# 0 0_[ 0W V0 00P 0aP`#`Vp 0V 0P! 00C 004040 H4 -( H46H4409 S- 4064040 l  R    R$rR    =;09#9S0S 4- 40 0S - 407400S4s400440, R<400S40  , cTЍ T  \ R \,  # P&0s% BR$ <` 0SW0S 苟`{0Si0 000`YP000V`S P0  `VX0 0 0Qz @0(`tmcd9Y==&=! 4h<T<N$<dv5ndvc  u<dvcpdvppdvhpdvhqdvh6dvh5 ;dv5p 3}:m2v1xdv9xdv2xdvfxdvbxd59xd5exd5bxdv4xdv5xdv1xdvaxdv6xdv7xdv3xdvdxdvexdvcxd54xd55xd51xd5axd5dxd5cavciai5pai53ai56ai1pai13ai16aivxai5qai52ai55ai1qai12ai15AVdnAVdh\X 68P5 ˑ̑d3?3a3-3raw )3$3;P2P2g22 P;)52 / , )0h%4"00S"M:7 0%4"|>ftyppiffmp41dash)cmfciso6isomiso2avc1iso5iso4'uuidPROFO!\i@FPRFAPRFmp4aVPRFmp4vC-H \00%P@5% 00r Ѝ(q`SR GUT ЈYX  Rtmcd0C-@0 P8<`?`N 000`Th|v04zweqn04ifXT`00[04V 0 ЍtaptclefprofenofC-P0 00@0 `pPP P 1+P tJ 0f Ѝ|>P L0P8 P O"z"F"S1G- PUU`&@0 P` `1pDUw`bdata@- R 0 Ѝ0200S 0 S :l00P0L 00@0 08  040000tXC-PRM!@ ЍL0"@`D$@A@5P @ 1@@@$ $0 0 p0L L0Y0 @@D0@AdAYG nN yO u q mP iQ eR a ]S YS pR$ QS dec3@- R+0`R3! Î PP0 40d0d 00\0 0P0 40000 00(0 0 ЍuW5:O-MP@0 @0@` s D0YB  0S`0 ,014R@80K4VUD0 C40< S6dQ3 `0`0,0H<0D0Z(0d0 Ѝ m,Q`0P 0LQL Y,0 04RK@001`000S HeY `00^  `00,0 T  `00(M@ptrunO-,MP@ 00P`p8&dP1+L(0W l,Ѝ 0 W᫿[0P0S 0  0ࣟ0S409  0@S D    ?,00 0S`0  0S>`0l0240"0@S 0el 87= C 00X0 00@S! !pRP00S14`@0@   0QP  0z0 S<A4  'A 0`( ?Q`0( ( R0G 0u\X H!R (0LQ(0CP!HPYPmoofmfhdtraftfhdtfdtuuid freeO-@M@p0 `P" 0  0@P P PP PЍ=G-0- @M00 pt`  P  P [ Z@4!  =ЍK X@ E P0/SP@PP)L & +{y *{t ({oH  0 @eB9loci^A-pR@80 -PP/ `PP* /`P ` >W"00(4x".+R PNKH00"datagYJR0p@-MP1JP#` ( 0P$ $0 0E 0ЍpO-P-0` @Mp8` P 0 SU RRT  SS  S $ 0SH$0S$0S5DP0$ 0 S R& P00lP00  R4`-V`` S$`~{ZR4`84V R` 0SDL0 @CP;  `$ 0SP0 RR]u0SrP0 Rn 0psh;gaG]XIH07Q[S`P0 R``V @L`X0&  pEP0 R& 0P3P#00H3 0?0 (0`S0p$#`#P0D0SH 2R iD" c0$xP08P<Qڐ/pP0V4  ` 0`VP04 84RSm 0pp?zh0H \RX 00G 0>ư>@encvFFMP0mp4v`B'd263  fiel   p ACLR0001AVdhADHR APRGAREShvcChvc1AVinaivxavcCuuid@hkO$_9#vpcCav1Cdvc1DpxEtgamaprofAbdvvCdvcCxpaspclap(@]tecolrnclxnclccllimdcv st3dsv3dsvhdprojprhdequiSF AQQ  P  P    R 000TX \ 0 10 SXS 0pp倰XWP   08 S 000eX \^FSX Rd1\p`00ph1c<0l1T0'SR" 0<000X@ PM \0GSڠ `8`"h00 S@0\`P0(0D0WdD0S `p 8p&80`|0g0px0 0tl0( { w( s o kP0 #f00/o"`<0/o"ZT0/o"T P LL0DPHQ-dM ,X  X \`0GS \0 80"_h00 S@ KNQjQ'0I [ 0l%1S0  h t01xl00p0Q4$!4<!<8!SJh`PP+ ߿  0NX0R0N?o20S 0VS0VSX0S0S@0 @` 0 `Qʷ 0p x0#rb(C#Q#  S0!h p0!033P00D0 fjS\S``K S= 336R kDYP0 R p d஽`P  X0S+ O=I4p ! 00CSF0 00 h LpP h .8h 00CS LrpP$x(( LhpP P0S T0S!(( Yq04Sm LP LK LF[p 0SM 0) 8zX H4 ] X 0S[h) kWC 0Sfc01401 R,:08 0  t* %P0<P 8 R ?lh}khwlt$0S (n\P00gdla^[XUR0S %V F$Ѝ+8 п+ +  ƿ00CS 70;+00< 0 0S00P0H=P0L9P0P50SP0DAo 0F,   0P# 0P#  0P# (0P# P# 0P# 00P# 80P# H0'@p'P :P 0. 0 P{ "x  08tb 0, 0#fT` '#0 Q,?K@9EB? <0 S :S3!-*'$!#h"eC0 00dcbmp+X0O-ScovrtmpodataO-,MP`p 0@\HZ0SP0*h R08CS+ 0/;R0Sdlx iZXHUP0l * 0+SfP0hJGP0gAP008CS`* 0ӑ6(3h0S 0S}(0SEP0 :A0CS)023 Q Q0  Q 0#Q 0Jo᪢P PP Z 000`LP00 S (HP0 9Q !h RP lh8Q Qd8QP+ )0Yz Xt0P SFhP 8A0CS7Q h0SP0 Rᘇ > Rl9vP00S ZDPEPLPt _P0(hB%X(U(:A 0C0SQhsP 0:C 0C0$jQdP 2l VZP $4  Q*H 6Q  @ Qp!v95 QQP*/0QQ+ 000 HP 4?0 0|P 0*H 5RPVP00 S$S $Sp!)$SP$S 0mTL 0 |P 0 $S' 000Qz$#P00"S ,ЍP0P0 T#S3 000&aHOP0 R$# 0 P0 0rP0 0 CP0 0hP0  B"S@ 000*tXZ`" ഷ\ 0?S00ZSZP4 4< <8S R"4<"<\0" VX0S!0SP00S0 0P$&PD! k0S& PT`V]\ $ 0P. dP&lpcmenca(P@PwavefrmaPmp4a#PI`E0 PP`5 0S8 #X4 X ,` P P`p,bX`c@`bD`pD`@p``QPb`pb,fpQP$P   ,  , <0U0Sw 0,0DpPt0 娕&%H0Sp0 P00S LP 0S 0S Sp0 0#)D0t0`P0 %&H0S 0##D t p0 0TPD0P5X%0S0S  (000(0/0000㎳V0D0`pZ+|yGuM0 #"^4 P RPR0~p 5@0@ 00PD00S40p00<0p 0R<050#0517 (00000t0,004000,07 % _00/00000.(0S(` |0 (S(00o`P 0#S`80@ D00@S !0R0^hpL WT! !DQQ0@SIW 0MP00S(0S| @Py P0 Pr Po V% pF `V(0Sp\pW 0W$ HZPE` P03`00Gmoovfallhintmvhdiodstrexmvex}uuidUSMTO!\i@MTDT?B&x?chaptraktkhdٚ[9ledtselsttrefmdiamdhd:minfvmhddinfdrefurl stblstsd8$smhdtextc608hmhdtimstmcd+namegpmdstts,PXrtp sdtpPP0#  300aP0SS@ D000S ?8 (08< ? (8(Ӱ 00 Rl04000\0S 8(840800 0R0! 0#0lQ! gWV 0S  00/00000!0R000x0($0S `WV( ؄?YX D0a 0$!(0"00 J`0`(00/0㪱!x0R0 X  P0 000x d~x |w!  0|%R0 X % 0l40 0%X  %z$w\p0S VDD Pp>tJ 000@. hD0@ 0@S`p !R00,+X!4!1Q0@SX 0!@0-X D0@ 0S%  <`0 `P00S  0D0@ 0S < 0`p  0 0` 0T4~P 0S0 <PC1P2P0 3``00Pmj/00gP0 /<08(008 0qV0%p``vp 0d%XAH>0S `0 0 D0@ 0S H0(<S( ༱ #X 0 X 0 SD)&%SH0 |)S )<S)S*SD0@ 0S *SS0 <;S& 0s`pHP0  R 0 R 7:Y( 0H`p q}n kYe;Y0 L0DX H`V0LP` ?  ?VpF)P`P,0 ΰЍ3|!-*'<$!L0 @P P D0@ 0S pɮ0 00`0W/Y p-`   @ (!(T=Y& 'PP0pW5h0S2x`P6 $0TYEȮ 0d`p )P`  A`P P0 R   RR  0?R 00S  S ;P0X40S 000$`p_MY0X 0D0@  R80 P0`V 0``9'3 `0`,( 0V! 0(`p  0p' T 0  `ZXV `0$P '. R `03$C 0SR 000`pY  ,0X0 t1S ]P0̩y0S S?0; 00㠐0⨐P vxP H`P P00 SSpp 90<9<)0049 0)p0XpUX 10P101 p1凑c_`03,0 0080 P <0 pP `0(00 Q`、2 4 p# Vp <X`03( 1``R01`0 1`0s0Q Q `00`0p ``0 3$   Pwp 0Xs```00$Q` 3 Q Y 00 Sတ $0 ᴐ0x 0GsRþ Y%PW%PR$PMD0@ 0S&4~(l iurolZf c`]ZH 4RD0@ 0SP00S(080:@0(0+@ <0:D0  `00R00S PH0$<S(080S P}nP0& 0 000 `(p@P P p ƫ   0AF`P  p 0 BRCڈ00C;W 0 Q  0Y 0 紐 p0WZ. p<( 0Wʇ ph( Xᩫ R x0ax00 {x(0SNt000,0&P10 f ᚅ(SP^D[XURO<  V00 0estscstszco64stco`ᨕ^`P@2T @F娕W0,pΌ 0 0,Ό 0 0 $0GHE0 $ 4/@P ! 4 ; ª4Ѝp 0p[' ?T'P 0pK  g(00 10p'^0000S  00ß X0_O-M 40D @㨕`q0SL;P㨕0 00UdHPU00 00Up`S}  @_ R}00 140   @P40Jn   00 000 1@0H0Ѝ0PX%0S0P  <P QP & 0&' P0!%SR(0噅(Q!APA!`A(`0S  W00Pn0 #"PLwP 0t002# >y PP``, PC<40  00 0S`㨕P0 H00"^00 1[u0,0S !`0  P0H 0 HPP0S@U  0!0 !PQ@0T`P; 0 00@Pp`ᨅ0(00V,!0' 0 5(`!#'`P00000W,@@T0 00 0R< 0"00 1 004 6#.Q P  Q U RpP `pP,@@R (P 0! 0!(0S0(0`p0 5!# 00S 0 0! 0 ` R0#40~ 0(Pw 0 000000 1L@dP80 LgLg4048<0 S,0  0000CS0 U0S0P0SE$ 409S\0S,0  3L00L00ulc 00S 0C=C@PCP@ 0U@DA@Q(P L 0(Q LLn00&0( S0` aWV# 0S20) /0Ϡ,1#`08`p(DD 00`0!,"[Vd`pS"L0PT P 0 ڨ? 0" f0, 00@00 0P20D00 R'409S[\P(0pPS0WO0W00 S0`5g&0S HULA(0 !HQp0 0R?0SO00U2%0SI HaP!0H1S:A`( SᦩP PaH1(pL 000R`(pG@0`(؀N 0 ?( R0X!ơ 0 0!*\0Y00# 00 0v HEmdat@BprftLuuidfreeHaF 0X1J(`F`FL1p0!p<\*D0 V(\ V `Bb  FL1p0 )L10!$`P L`@TA-@ P`HpPW40 AO-% `4M @P00p4$0 00$0P(0Pg40 H R4 R!(1SJP((q Y:\0  0S  c\ R"\8 . H:L0S0D0CR0 P*`0S `p`P  ! 0  x=x-YYP0t0 0 (Q g 0S <- 0 4Ѝ0 0XX4P1=H ̟AR RČȌ'00 Q00Č Q00$00cY00S X@P\ (0S aX 0\X0@  @ RcR800R0R0R0S, XX);H ARRr ' 00Q00Q00$00S X@⾧P\  \@  ߤ T;R0S0/0?0 0 01"0+ / + v RX0SL\00SH :HʟAQ QČȌ00 P00Č P00p 00S/ 0S  S (P (9St1S 0 ]_ P W  d0X:@ `ᙧPFd 30`00000D 0PŸ 0` SÌ؀  $ QP, @!R!4048<0 S 0@S( P 0 'SR!'@1S 0̈́S P L0@1!Ѓ R0 0!0 0 SR$( ༦! pQ!PЈ`80Î080Y0X C0( ,0ЁX؈YX0 0 0( $0FR0"Y00  # 0 V, 0  Rp@  YQ\1S0`1`1S X d1S WR(X0S9\0480S Q4!4<!<8S'0S  S0 0(+0 0*0R0S S$0 ( t1S R]0S 0 0  0000j P- 0  Ё-XB@1! L 0' !0 H0S ! $ 0  0P 0  0D IR  0,  ᣥ, 0  R@ \$ ,$,,,(Rp R R l!:p90TXq\1d1S7 h1SXW `03,  , 00000NW h1SQ0X000d1W0h1`1SX T1S W X1S ` ,00,0000` #0,,h1S00RVP0?S00S  P00S  R4"4<" 0b@PP 0 SQg? pP505T p  R0S 0 X 000T@m MpO-u|M 00@H P00^0`P@@T@02H0?0PP |Ѝ00PTavspmjgd %I(@EPP0(  T@P1 004Sᠡ4$0 0 0a ϡ!, 0(0(0`p ¡0 `Vp fᷢP 坠pL刢P`H`  0?0`帠00000 0H[@textftabyo/O-` PM@0S1䥟㨕X0Y=40;0#8 4S4 00 P- Ѝ0px'PX@=P\P X  q\X0@ ]0S000px'P00 S 0S! 4pp} 0" 0SR"p% (Hl0Sp t0 04pp" $$  ˡ"P'  R0!" 01l0 SڊP}l0 00'ȟPXX0  R4#0  ㉡a Hp 0P  RA40  "  eP:0 00p'p0 p 0u4w 0 01 000f4`@`5 0002# >00u6'H1S# 0CLmDroHlH1X `0V_MY0 00jO(0L10 ]L1 0U pmdat.freeˌmfratframfroO-M50\00 @ 0#D 4S  408 0@00S800800<0< 0S40  l0S 0 00l R?40 4$P RX R040   > 0 Q40`*0S |0T03`0X00S"Q40@\ 000v\T SN4V(RN0H4 # D@<80S  p2pDp0T028p0X020`008 R:th$40=;09#9S1 Pw0PP80080U@ >P< U01H0002%H00PS   R 0`X01-.t .0| d0Y 0S V7H0t 00 | l 4 6 dݟPp8040 0000,00(00$00 0000000000 00000000y R\`X0 㣟P\`H000S <00 〰%|13(uuid`p[zΈĈ5F?:3} 1aivxAVinۀmdattmcdX~ h~VrC~#~q~}}bq}}q}j}}|||P||P||z|s|m||{ |{%P{{1l ShS$s0P T0 0~/ T0b  l !0h00P0}  T0! _ @!0`01P0}  T0F  R h0` 80l 1k Pg|0t כ0X0^Ё  ˞\ 03?0`@V\ @X`02H4AQQr 00\00\00t 00cR00S2 X@ΞP\ H0X 0 \X0@  P0&SR0 S < R  ! R0 #"PQP @@PHH QT  T 0 PPЍ 0 000S30 000 40 *PP0tP  @ -PP@00@0`0S000SaD0SD X@lPW 0 T PP|0u 3?P00H080@0@ 00P `0 0琐H <0S80  t < 0F `0@ p5`H0006'00H0<00<0<0L0PP; 00H00t L0xH DP- P0 0 KPXUY80080`n00U8 2% D0P0 L0T@00@ @P00S` @P D80pD080S6060 L<0ZP0؁ 0P0Dȟ< X `(P V0@70D'pH  <ᢚV p' 0 @000I  g0'` xP0 R MR< \"t0Pt| QP0 tʛ8 ( 0 XP080 tP0H4 nP0\0 hP0p4 b< ;o   FR8(0 +P0 `R?(0S2 S58(0 P0 K\$)P0 @ ?< &P0Ph  P0dl t P0p R 9)0 9)0 9R9)0 PPA4 0H0  0 0 P3p@-@ @Q @PT@1͙P @pp pC-@P 000 0`pF 0V Ѝ0S p@-P@`0P 6o`   ! !p/C-MM`@ pTڍЍ T P1Z#0`  O@Dp@-@FPp$0Q: P]P$P 000C0 0001?0p pp@-@bPd0P00000 S   Q0P    pA-@`pPP nP0 AO-@`PP,`@T*0pS @T @p H% 0  X  80@CP@ iPPO-Mp` @D@P?0x00TЍONT 0 ホЍ  P 0 CR@D0U00U0S P 0@  TE  0 @DꈂQG- P0@x0S0 b`pB 0 0T } R0 ! } R0. 0 0s 000+`pfT`0SW0S    0ЍGLGsencsaiosaizG-0PP @`p4" .H% 0 P  p   0 0ЍsinffrmaschmcencschitencA-@P`p P P wPPW`G0S/@-@0S g0 0C0@A-pP`UU@@OPEK NpT    >@R/A-@p`PP 0S  P0 00 0p0` 00 0G-u0`0Pᗡ$0 H0 PP 00H0 05P00IiP 0㗥%0000堐Ѝ ( 0 ޙPr 00rtp M|_O-U M0%\`@T ^ \T     ,,0 +\eoY`VV`[0P0Qhy`@ 000\)& `YI0Sd$#dl#lh V00V0S8 0 00#`p \@ 0p`O\00''T000$0000 0S h,\@֗`p0TЍ0@ 80r s0 SRA0V`0嶠S$##0Sp庯pAW+ ?p+'SR+' 00 0 #zW0 000W g dX \000I@0 0F000 0L0"0 00Sd0   0@0C0 00#`pdY 0- 0S0S0 00 (00P00[P`V0 ^SJ(`0p@D0Hp$HpD0pVWC/X80$000[  0  (JJ~p$d0Z0d0}$0~L00|$L0 S`F P Q[Q0 0e bؠ0S]P   B Bŗ00C0 熖p@00 0xA-@PPⱕ`p0V0U000S r)A 0S `0@-SXtzMP P0SS0 ZPX P 5O-`` M p@$`` PP 1 0)@ 0 09 0% 00 PIT0 X9  p00p⹒P>p00<0x0S80S `= =00 0$0 0YX33: 0X0 0C?o20R0h(1  nL8L(P00(000PP_  Z 0 T$ 0# $Z Y X 0 0 Y  X 1 1P Y X؂"#YXl'0 0  0T $0 0\0|0`00\0 N H4 70P00"0  00& gX ,0p "d 0 $ 000 00$[dZX00 0 d d帀53%0 0%ő(6SP0 h6SP0  id03/5RRA00R0S-  0P 0 N R 0 L#  A!0 0T0|0X00T0 蠓X$ 00 OU[Qx`Lv`P ` 0( `4T0d @Β00#$ `0S:3P -P  0-$* 0S$0S #< ?2 `V 0d0|0h00d0 A$VP (Q0| c!?`0SPM0 00`pP0(0V0S$ 00%! 0"(00"PD00!P& + ? Ђp0 0˟ 0P!p0P(12!Z(  0! "P.Ѝ"#"SRq@! kp0! 0 { ! ʿr00!P`pWV`p1V 0p ` 00#wcPU jofnIgniXiifvaLEMALjgmIRBV dcYd_d404 00$0 R/R$0/APIC@- @ 2,@$ p@- 0 CSR   pP@ R P  P PP h   , P @   BoR,Pp  2cP cc%cO-P @TM0,0 p@ 0T (P `$0 l R R  R  0S($ `5948c!p 30-00P 0#0༓  Y?ï " R RpQw 003#003 0yl#(0 W 0 ᒏ0 P 00$3$#003 0L@Ao@oH(堀X `pP H  B`Os(0X`P00\`T0dy`,V0S` `00000pD P PePI!0     vIpm(  B,0 0000 ,0080TЍ  h R R` d  ᩑ*hT)clRb,b`ardXing``]^p@-@ P R lV` 0S $%P `(00oOO`Pp 0@-S00<<S"Q0A<O<Ѝ$ `0 0<\C-@ PLM$%>Pώ ` p<SLЍ Y a`᩟;pC-P @` 0,S<S  0 ԹPp  ౐0<pC8 !؂YXp  <S 01"R0 ZOPp<0C<Sp[0p@-P ǐ@P  pG-P `M\<S L% iu$0SW p ᭍ T00A00G001 @O @0 @剐0P  m@ǐq 0 @vP 00@L000 fP (4 P@⏐Tڀ H0S 0 00 @-<S`p HI ,0 n  f  o  H,0L 0t2/ H,0P 02/ H0, 0\ *2 0!P ?,.PdX0 P7 0S4"0H,僐 %0Ԍ0 Y 2Y Y0 402"002 0늆 4 LD Y  R&0S " P0#R00+? )0S 04 R00S000,0p 0,0k Q P p Q0d@ R00S  `ᯉI01 шP <400 000 00`&, R``V >40P0P 00H0 0 @@B_FFEED1DDCDAC9D0Z Y啈ZJ E>0L0L 00T0 0]p돋1 A  1 A  " 1 A8 J" |,0S[ 0 0 020#[# 0#QR YKY @P 1  0 00S$ ?$0 01K0 0020 #%#0 SRP \ `H0@0 S0Tp`XIY l40404 00,0 0 @jlC_@Bs@-PB`P@0SЍp01 0ׇP 40,0( 000 0ࡈ+@A@zAO-p-`0 PDM✓(001# @,000S$00040P0000000ᙅؠСQP1[Z ?Z04S40Sm "z0 0"v00P 0#P0"00h" 00>0[Z ̿1 QP "S|R000 00$001 A   ! 1 A8 0 S00`P  " ,00 d1RXT!0 DЍZP0(0H0(0`0S P404 S  R 0S "SR #P P000,0"#(0 (壄3Pʶ@@B_2@?d:0 0 C C C!$ C!(! CC0/0@-"OAW@@B@@GH@P t@r @ @D B4000 00/ 0- 0S 0S?\4 ,4<,<8S5 04 80S0S* 00S& S0S\4 ,4<,<8S 04 80S0S 00S  >=A-@ `p0SP@@0T,!Ѝ01 PU ,0P 0@,01@0 @-0@0 0#X ? 0 $Ѝ 7@-@ Px0S !02/ !  Ѝ0p@-`QP``0Sࠃ R- 0S@TP@  L 0S@T^ R0000p@ C3 p=G-h0 P(Mp  ˆ@P80 Æ@@0`! 00 1 0T0  `Pؠ "\@P) p0 @ F00?2P  N@ԄvP @,ˆPH0p0 000000(Ѝ:::\:p@-@P၄  pO-P @Mx0s >Px0x00|0<0<0;0x0hdS V 0 0000,㗁0 p= G00C ,$C ($C $$CUݍ G0Y0 B4 @000 0R0000 00G0000 0000GY  0C༠jZ  @ bRڀ 0 3/ PE귱pC-MG0@00 C$00 00H000 00So0 000hK/0 P`K/0P<3 08 04 00` %4< 3 ~00嗀[ЍpO-SMM,0 0L / 0 0D$00 /0Oh500X0$0X 00?o2P Px ( _oR, (R  R 40,?(/00 ? 0  "1P 0P l5s0s0\0000,0S 0h% SލЍ0X0S! @SR QP `Rp#V0X% a 0V 0 0d0tC$51M?4!0t00610@ Xt M?B B0 0` !SRp QP a#`VpV0Ka 0V 0 0 N/@0B QM/0C 0\ 0@0@ @0R0X0S0%P0@ R0V> SR% ,0V> 0%R0X $0 PZV> SV>R !c  R0Kaa#0YXqU,40aAt0 tp t H  t t l  !   t 40 B B t  B B) BN,01LBB0:0BCĠBi,0@ 1D0 080D02:51C$N?p0804!x0S pKp0 p w p0 p  p0   p   p0p p0S.0C?:71C$06!H0404 0R:H0S* #04 a0 @ Ph4S D0"0S400 4\0M?<0< p00CSx)40  p M?0 B80 D 0D @0080x0S0R )P 2FP P P p圁84p000 0 ́P 8Pp0 p 0pP:C$ 00Ⰰp0`0S=y8(PV ( BP 8P 8P 8P h0S PT )FPO  P 0@S pE74p0P P6 WPB tP  P:l<@P(P 7P $:$0P& 0P'P 6P $7P&P 7Py $vt0o0j0(0Sa 6R 800 j00000p0000 5R800 p0 p z p0 p  p0 p 0 5Rp0 t5Rb< p00C#S0H0uTpp0 p  p0 p  p0 p  Xx Qu0Sh Rep0p 6S^hpW[ QXڨ400 GZ R   }Pp0 p  GWo᪢Z5 0S20 A|P)p0|| p p[ p0 p p 0p000p0Q Q#0Sp00Cp0p0` 0C0C:0C$ Yh#  T#  p0 p h R$# h0p<0l JQ5,}d~dh0l P Q& Q#ppppp0p p  p0 ppp0H02[t0 p}P0$"SY000p0}Pp0 CKtpp <00B?cSC0p000p0 p  p0 p  0S0pp0CSp0 p  0 0 p0 p00p0 p 0    p0 RX    p00p0  0H0@B_X//HDMV)),P(PpxP;(1PP0 S00RX 00 0(#0{0  0} {00|0}0@0}0@XN {0( }  0{00|0}00}0qV> SR@ K/0 V> R0 %  }K/0P`K/0P,8#0 400`  %4{<3 ~00 405%005 0j|0(0|0/@00S 00$0 0S tR   0+S 0*CR?0"L&S0x0S0B00$00 RPPP6U 0PE0_o0RS 6RB00P\0P0l5S U>0 SR00V.VРU. `[ZР$ [Z[Z X0@R`tP00``xRP \00`U,$c$0P,,\RPL$@ $  0U> B0R 3 # SR U>0A ^0 @X V>@ TV $000tS0@0D~00D`00D0x0S``V $00 <9R0@0D~00Dq00D0S0    @U   @z(0p D,0PbS``PEU{ 7 |0(0p B(05||0 0|0y0f, R00S0 (0 FLz031L0 (0L0,00C,0000&00V 1 U 1 (0 BG|{0U 0{00E|0 } EG(0 LzU O-` MPp0Sx0S 0 00p0 jP0P @`0SЍ0 @ 0S (   Тء, pHp``0S @-/0p@-S@TT$Ġ $̌Ȍ\- @ ĠȌ\% @P   {tpp  {0S 00S#$,#<4 8 {$  {p=O-@QMopЍ0 0`*H0 0D P400 @*0x!! "L kyP00<0400S1b WV `pbaWV 0!0QP``S``V |)  }{ly `0S$` 0 80`0 P0` ZpPV 0 0 480S`P0@08p0D0@ 8){P0D 80p L{P00S 8 R' S) S S`[{PpH 0  y y000000 0000S S` \4 4 0\ S!SR "SR ,`P 0R0H00Z S<0  0(000" ! 0, 0 0H00 p0S40\0YW B706&006 0+SM0S& B0/0?0 00S|&  zP080w0Ёh0Y0Xl0 60060&00(6 0z&w0p0000 yCpP80D pP0⎳Hk00H``S$` 0`800P0`Q\4 $,4<,<8S,  0$(0 R$ "0% u Sz$0  Lz0S 0 0S#$,#<$8 7_O-P`lM@0 01 0P# 0$  wa1 WV `pa`WV ^f 0 ŕ؀aHp>WؠC! !#SR00QP00S No?  p80#! 000QP00S 0008n |wF!SR 0!YXV  WS Z1 QP(` t 0c 0d! 00>w$0 - 0 S ?0(1$!001 0+ws0 L`06/0`S P 0H0S` 0" 0"lЍ0403/PWЁ1 XQPH` Ct 0 0 0 0@B  @  @-@ww@gu0Q@- S:H   v 100S  va R O-`pP0 0P @t0t 0[PS  @S `p0SU0W V 4SG-`p0S 4S0004Ѝ00 R R@l0 @Q@0Cฒ,0S^u,2,Z UT T0ŐdX0 0 ͱ  0 s 0 m A p A-pP@`PV00` VdtXTP P@QaP@@-@tT0SP  R0  L$ R @ QR R Q R00A-`Pp200@P= UW   PP 0 uPH PP 0 ,PPڶtP  0$0S 0 `rVP@0 0+ 1vtP   P u;O-Q- @pdM`D ( utP P  4S tP  0$0S S %tPeuU0S0S* ɋ$3000[%*0 aP0sE 0SP 0S Sal0SU" 2000<0 H4 " 7u0  0S,P'tP $ R q  sPH4] P; 0 " u00s  utP Rl0S@1 !p0Shzt ps븢P 000( P 0S  Q P P0S `P0@pĠ 嬨 r`s Ppq Vst 0 t800S40S0 0  Mbp?R_yYraw "X<08<0#8*QP 0SZ^\ ??S + z;+ qa  Z\00^00Q00g  0D It8 31Puo ,0S %000X!X dqr`p 0ot`PY t000`Z :/P0d0S 3/ dЍ0 r 5 \X 0`0S Z jP 5s@-@\`X0S 000 000S 3/PP0S HPU`+"@P`P 0 1-00P 0 01 5\0S(PPЍpO-*$ 0 $S ء Q PN*0 0?o2ᓢ 哲+!" 0᫰j  0Pp0 2#" P R 0/ 0!С R 00S Y $0  5 ,03/P Q 0S 5P0pH0PP\ Y $0   ,03/P@H@ 5@H@@BO-dMpRZ`0V[ %KРXPPZ  UP 0QV P EQW H4 %SR 0a1 P "0T P  q%SRXpXU UH @<@p0< 0!H0S000T00q! PdЍ !P P  RR0`СP 0!@@PD @ 1a0 qX100H040V ! R 0!0 P ! Cr0 R 00 HPL 4  {q" P0Z0!\! 0q0X00 cq% 0R0vH0<@PS000T00vp<q e@Tc@B@-LMPp `0 <@0T 4/P@ @UpTLЍO-eM`P$0@4 0p o!Pp o 6&00 q2 0|p0WX0ppWp 5@0S0000; S SR !SR &0 q 5 @ 4%  n  n! n, 0%00 0 0 0jq#RQ  4% Zq 0##00(0, @0ᯚ,Q ( R 0#T̟  ,0Un SRQP00W00S  0QP00W00S $0S$ q002,0 !ؠ[Z !SR00W00S g0 $40:40W Xow \A-PMpH @Pkek`0S5 0U8 PR 0P 0 01㸢0U80-3/PP cU0SHP`0S0$0S m _mPЍ020S 0 =PlUP`3/0 Dm0`b?m\ @-D@T 4/%/%A-PMP@`pH wl0 (p0!0 00lh0S 0000(040,0PЍ00@-\ n50T0 P 00D0 0mtjL^ 0  Ѝ/% Ѝ~` ( )$ s`pEVH 8ἶP3؃0|# AT44UdP@P$ 0` p 8#<@_0..0)0804ß0v>@ 0X 4PB 0 $cP@d xcd0 R p 0x ac@P pЍ0p @op/o"Q  R ! d[Tpac0 0000<0@004080S <0S 48 0HD@0d[ 0000 "<  2@0|@P8;70400p 0@@ @pP0P `  cPPT00 \0Sa \00] RP. T  Ldpz0004qRD8L@BVZb ?16dhAoRQ8 NQ0Q0 0Q'0 2!$e0 000080040?!\0S800s!0 ~0QpD! 0[l0+ Sp!  @ᠧ!0 S60S! 0!0SS ! c0000 0 0 00l00 ?  ?b\\0Tp4" 0 X0cL %pP S+0 |X00T  RR "r ch0S" - 0T0@ pP0b0h00l000pl0 ? ? ah Ÿ! b؂ 1#0/ !.\ [M0 @cP cP  000 0CR # C$0 "cpP^  qwp<$0 cB0#0 Sl40# 00 0S40# 040#`0^ 0 000 80RS0080B0000 1 @00 80S0_P  R4"4<"<48`$0 R4"4<"1 ,  fc 0Sx00 0  /`0Sg0d0 pdP `Edp70K  ,c Np%WP ?9%OhD%HTⰐ0003000WK:000 0SPp0H  ,& ' //ې 000啒P`L0p@#@ ዒ0 ߐp 0 ႒ 0S 0 0 1㓓ЍW` P```H %[P< R801 C 0'  !P p R`p01 0>`07'pᩐ `WEPfx'lqpda`0`0,00,00 0 040 0$0$ 40 RSj R40p $0 ? ,z 0 d,  $m (ܒ0ǐ 0 000A9@j/,}uR64#<h(?7 . 0 p 0p"? /  `[$#`tWV  B ` `S' P 0 , 0 a<Pt 0l g , o"0 ᰏ!  0S& 0ᤏX!0S Q~0000S 0S 04 0#003/p]r t0@- 0@ `P p0S0d00 =  $P gގ 0T ЍO-M PT3p 0R @#0S80S $ 40`@L`0 H00 00אl0S 0S 2 `0%>PЍ2 0%>P 1 ` 0 ᬐ@  ቑ<  0 l0S 0S Ҏ 0<0[:Ȏ ݎ0 00 0cẎ0T0 ᱎ8 1  Ž0S 0 00`l0S001 0>0kP80  J(P~0S 0 0>0QPp 3@`<0S8 1@ `, 0$ yW%Ȳ@O-|M<P p000 `0010 0,00Sl0S$@Q  =]P<,$@ \ |Ѝ0 0S0@ 0LY)0 !Z: Q 0(0#2,003l0Ao\Q 0S(0S00,0 ;0 R 0 (0Se,0Sm So Sq:0.=0mnZ 00@0 `0s0`0@P0@`0P0!Z# 0@@0#2S S S0H00 000 4?LH*\0H0 0L00H0d0 Z 0 0Q"#"@0 QP0S0@3@D0Q) \) \-S, R* R d90>X90 ocSb 00SM *R  @0(Q$!!p( . X9  0Sn 000!02S1 S2 S0- 00S` sXP004 0G[PTU[P(O4X000 4?LHx[0\0@0S 000 00H0 0L0S 00S('  . 0@\   0S0\0& D0SS= 0@T 6R0 0AP BH HRL1@S2(0 R R@ S@ & ,[0(05B0> @@0 @\0@S 0@$00 4@ @ x0(00( <0"<( 00>$0@@0S9 Oz  @@y{P4% Z$% 0H L00 40&0HL ? HZC0140G0?o2(0E0000 0@ @0@ ( ZYf<000CS0I/oS"P0#d1S RP 0\0ñ0TX0d`  X0` c oZ B R 0QX0P X P0Q4!4<!<81$ `QXX # Q&@ Q3@ J$0 R 0S00@00S0(00000 0(0|2A0B>R (Y!( Y@2"Y00 0H L>$ (00p00\,00S! PP P 4 @oᩒ0(, 0X h1 0 R<l0m00 0\0l0 ,10 Rd ` R10>C0CPPl0S$ ' @弰$0 0$0Ѝ' ?'\"&5|l\ثt Y x L  `ܠP 0l1 0\ X l X0Sl R 0 0>C0CP000l0YS$00CS3 1 0 =Pzv L4 $0AA0 0P9 XY@p=:Ê0S 3) 0៊ 0ᛊ PUzw0 ዊT AA#C ፊkl0S $'  ,@0⼰'$00$0 ,0  30 Ru00 Rp`p P@`  X $@|sÉC00h0ṉV>30>C0CP30 100S S[0 0 0 kSY$0S8$@ X 2Cx 20B00S00ɉ00h XXΈ j  ' 0% 2LA-`pdP@RPd WP XP `Pm0@UT0D軧0 C- M@0pXd$P TЍ0`0`d0 qT`0 0X@ҷ///Qd @- @@0@08WPXX`Ѝ0@ G-`p@P P  pV006W@P2WPV0m軧G-#W\@P`p †P WPXP0T0)U m蠆/0SP/ SP/A-P`pUp@W0S uUpP  AVp 0 lW@F@-0P` #@  WP P  VW 8VP W`vTPЍp A-P 0p`  P㶀@P  U@PW@@dЍoP 0 WTp@-P`@P @PVpG-MpP@0101HP$!0 V  SP 1 _W0`0c 0 s s* ss% 0 P  00 0 WP0 0 P P`d S0PS 0 D  V Ѝ ͅP   긳O-aM`PVl&Z0 <0# { 0@T&4&  q?? "600000TV%<0Sn0<05<P @d NS%@ 0 tV0>#` #!80000 Q P R Rΐ\/$0 @-0@ aR@SA-` @>SP(p SSAS P$R0SA-Pp` 0@0 Ad@TA@ cqׄ-o@&P&@TP@PR0 `Tp 0p@-@PQ0`  p@輇p@-@P 0pO-P`$@0p @ R@ P @P ?Q,0P@S >SLØ>  !Z@@P ?R 0 0@@S  ,Z ZZ2>0PP K 0G-MQ`p 눑 @PG|@  0 @SP@X1T 0S>00S0S@ڨ R= ! =S v@  TP  ?) 0% 0! 0 ?  QލO@0   F@H0$ 0 D0-ˬ]\O-MM( 呋pP4P0030 030$0,0X,@ ? (寋, φQMߍ `( Z0@ # RR`V `0VSVP V( 0( (P P@@ R RR R R( 0($((0(0 ?(0(` ~P R RRH R00S#$,#,8000Q4$!4<!<8!  ]R 00 10 !  OR10` `(Pp 0(Z \P(e 0(.<(] 0(& (!` @(PL 0(6`Z P(@ 0(*(8 0("H0S P(, 0(0S: (" 0( jp 6 ZkQC1PPO-@!p`{먠0 P U  01 ? Uۃ  ᫅΃l Ѝ RO- LMP `2}K p @ⰎPUcPLЍ@`l T  SI0` 0 `0DTS:DSL1_  T6@@YY00#R  R   Dphರ[000-0㓀(0 00V pW_=@dY0pG8' 0oV#4rps0W4`4`00S  MP PpPT2l6&O-0,M @ 0 01ⰉP~P.?>S0 >00` 0.0.0>V: 0` F,ༀX^ 0pF# 徰Z[Q NVpG QP ZX \Q`p V 0 0HS0 ?Y- ?Y'  0Y! 0Y 0Y 0Y  ?Y  1|Y 0vV0  ڰ.k2} B ` p?f>Xr>S.?\?  } 0` 0P S g p$P(ᨣ 0 sPP 06 02 0. 0* ?&$ $ $N/> P =붟Ѐ0S200 0HQ>>0>q>q!`?>0 ?0  ~0 q0` 0S  S  S  0 0Q5 (0 > 0 > B!?> 0 ?>  ?X ?ᡀ ? ᠃0S# S 0   0= 0 {O℈ ,Ѝl ? 0h ?{0 ?v4 ?r8 R<0S 0h 0d 0_VzMNxhIN[@SNޞ?S< ?  P 0 gP) 0$04HP aڇP 0/ 0L>!> !> B!¿ 0 ! P0 0 EOP$`?  ߇$ M,0   5xhINO-M0P (0>S00S> $r( NЍ(PLLL4FL>S  NPT@@ p`th000S,0T`4S @?>0>7 0   , , , 0,< :P10112ā 0 ,0c<00$0 0<0 , ,,8 P0`0"āT0` 0V;nL(M+:000;>0 S <06&006 0SNJ0 0 0 Rl0Sp t0X;  t0p @뜮p Wᇑ>   0J 0P. 0(Z$)0p/t@" P?000 ^0 ]]p104~0XN刡   0J 0P  @>W @p~`B$0$ P00 08001簠 R   @  L0$SP@,0 S00R0S `(0H&R0 0 000  `)0H&0 0 0 0 0000S 000Sp0S0 L0 7#l !?ᵻ0000000401 p cs0D00C&00 0 pp `0F3040040W000000000S0000X0Sx 0p00t00x00|0000080p 0C80D0@0 0H0ᓹ0 `000D0L00@0p0 !004 L C&00@L0@0 SQ80p0W 0< 0 0$00$0D H0 l .h0(0T!#0 h 0~Ld0`0C?oY20S Y750  eA0  ^H 0B#! 少  00 S00p0 0p0t00x0040 0 0 04000C0310S  00 `00l (ŀ(}(P4S04 6XPMԡ'PO-TM0P @س 0 >S^ڼ>SX ,CPT,`80p  IP0P 000P>Δ.!> B!Ÿ 0|.?x>U400YR: 000A@PP o`⡸@P*0@_@PR 00   P@0}$4 ? oATЍ &82 P0$00$ UJ4 "". 8 #2 0<0"".#2 0 R 0!40 #갡(p>P 9'0 >UU $0允 BQP K$0$ SR R,QE ʌ  !E?ሱUP SR00\PR 0$0 >X$0 SR Pv20804 00(0 0K-HN#/gXN g O-|MP5 0L0(0 @(`h$lD0>D H0p0,0 R 0h% yK SRL%( pK00,0 S0 >S8 00h0P0|(0 h 0q0P00 hilh50S8b,00,0.  ۷0 00_~P 0($ZH0D  0 N~,>  ̟Δ XZ ΔS,R0 0Sv ! r 10"(00S~0 00ꎄ~d⦃0P0 > !> B!d¿ 0Т1 [dZ 0 R (" .I2> dJ0p02t0x0  JΔ圀 ᜑ)Jʡ ?x? 8ᴃ>S ! 0 N0P0.?ὸ0b SRs"401!001 0J G0808(0( 0>8#0 0"H000 0 {0P ҠZ .ͱR !R  B<0I!<00B1Dꐞ(0 㓘)$J$ Rj >S0!Q(00S iEKN@Bߋu A 0 QP  [0 0ʰ> Xo0<01@0 00X0尀 Q0 F0G D ?f0,\0] \0Q6  ,0#à,  X@#T  X0, 00<0R X0 00<<0c J00@ 1@0Z<0@0 0@0<0 0<0 S{3b40828"00@2 0  [ Z ڈ <06F 0P0 0<0 yà 0 0à 0  0   L 3帀0 <0{ Oz  (* ?O ?I #D  0,K+~ ?9   ?2@@ R{vz  8 l$} 0 0< B}H0D  >0(. `` 00 x$P Ѕ SR  `ζ\  F0>lG|Ѝ{ 0؀F  PGP 00 R 0p@-2_@Vp,0S/? /O- P`p@唀0 ST@0 1 [ 0 RR00R0R0S GG:oG@ P#P (0)1020 0(  bF@4@,@ p  VFi6#0 $SR >PS P<4S _"QO! 0@P!1@P 0 @ PY  09/Ѝ0<00P% D%  {::{|p@-PP0@0 00U N@PNPN@P $0UNP00S p$0S 40S /0S/p@-VC@P hAPP@cApV."@D000800H5000L5x?$ 1 U#(%w|%&//hwQ@-@ A+@zAyA+` P 1S/@0 P,00! BP/@P /H 0S0 000S0/Q  R /ဴp@-`4PPPE@TpBP@p$G-p8@P P`PPE@T WX A`0S |AP 0S sAP G-0@PpR p\u;w`8w"+XX`0FF000Q0S V  R P5  A/0f0VЍ$($0C ?P V V V000 fU0 S S$(S$ 0000000B0v`vvVPX: 0=P P 4?PP+@PP&WP 0D 04 000Y0 0 PЍ P>  =P@PP A-PP@Ѝ@ 0P-S>0  0.Sp l@o'loFVLW `S%a``000C S  P RPQSA-@@ p` PP 0P 0 A-@0 *@0 p#@0 `@0 P@W@VpU`TPz0 Ѝyyyy0M 000Ѝ/`X0M 000Ѝ/4Pp@- PuP@@ < 0T@p跱p@-@`PU  @1<Ppx0x 0@-@00rP P 0 <0P0 r 0PT0Ѝ般P O-M5 [0P0>>DNU00se1P@P` sh sl s>a 0sp[ s 't@ $th )tl &t>a 0t[p0 0?T00 @ e1T[ppӺ sU C>Ѝ sPK/PX00T0S" dClsP@pP  ms0d0` 90 ~;P JH(PKXh0 rPPE` @ 0  ^;P 0 R;P D200 P p $pp  @, P00 hp4 8 x 4 t 0 p , l $ PLd  D  P@@  < d! `P\@XTH0(pP>U ? r0`0l0S+ ! >>@D[OoB@T K  0QrP} 0 hpl  [- 0Q`` Qh h  @XRh@l@ HR ?0 |J1P p@-P`@rV`r0`r4|rPyr ~rP{ryrwrursrpO-$M`@P 0p00p 0  R0!0 00pP0!P000P0GrDr@rP @TZQ ! =$Ѝ R0  R0R 00 UT00S"  000Pprr R@0 R0R 00 UP00S  @PZ@0  0q00S  O=F<P  D=  00sUT @  2= 0  ;fKց@-@|nyn0 00BpЍC- 0 *000 000 0=9`(p0 @0P m Xp0ppDGn 0p p ЍO-P`@V 0 F 9o᫲pk*w 0Sjoo pbYf0 S` `Goob0((n0 n04S[an2n Q-nm004 0S00BQmmmV 0mmXX pY OymV`X Wm 0XX W Y `ZA-p@P`{;p0Pt0P l0Sl00 CSR0000 p?t:@ၨ}p0S100!l ! A-Pp`J:0@s@mmjm@pAm0C-0 @` p0 pP0v0S Ѝ0 3<PP pPph8m 0 <P P0S 0 ЍCԞL}v|INFO o0 S/S/O-IM@ 0PP500000n0/0CS@p:h0S&0"l ; R4P ;PmS&0S000QP00S lhlll8*@0BRS00P0S`:`P `V` 0SV #` J;p Wy0 吣Z⓲+l ?e0GQ# 2!l W2  ء!0l0ll0#Sr 0 "0 0q50,0"- YpC 0 04S&SRllY` KlT2Py \200%  n0 00n0@@ @kIߍ1Wl `=R= =Ӈ1W< 0CWh0,} W0z p0Sw ?8h 0  Ш0i S 0 00  "0h0S00000233360S 0 03+8C>C$000*0t SS1 0"0k 0S 0 0dkktkpk  RSy kut(P4PO{!P|PΚެP8qp@-P@v8@DIkQpCk@-p0MP@000`@000R k `kk`?0000 %:{kkWЍ@k  A- !P @$0 R Pp0 $0 1R`  m 0j`jU000`?UTpڬ 0 9 U 0 jVj U "kkjiAk>kP(vO-j ;j j  jjQiiiT0 \Di85i$0S7$0lp 01#!?ᑦ `sliiidi\ii9i W } W>s"`p?(00,0000(0 G8} W ; W =Witiqinih(PT!  7<Ѝ"3i,!i$00S i$00Oi$04KiP0  7;ii2ii,i$00S`hD.RMFPROPCONT<RV20DATAqqMDPR6q.ra405Zpkp@(onVIDORV108n0 O-0 SP` @0S 0P  ^70( pP4 P0$p 00S SP@u6l00;0P(@ T@ 00跱m@-@TPP# P `000MjXpp@hh0 00?j0S S @0 D0c ЍnhkhA-0P@0 0!j`P0x 0pR0Fx\ ` 6@ 0@joh@ 0jЍk0p@-0@PQ h0S  6pT0x  l0Sh % * \0RT5Lp?h1 0 /0Ϡ,1# 0#0Ss00H4 0,c5P0@$80R@4 S S@4@$@4 ST#P 4x<3P ::@S$3P0CP*60CP 0PP04PP P[ @4  0C(00 Rl0 2Qx P0ST S*tSF SU Sh SK P;SY 0"Sa S4s0" 5(ST  S:"S S20X0SI S ASp&Q2QPPJ ! @1T  x(㊠0P(4sd! *4TQP134sP`T @(``FV`p H0T P (0T  BR0P0T0h01 PPT (` B0V00R0S 0P00T0P T0Q$0X0.p`FXPP0G$V P0 H P0 P0p pP00 Pq @KLcP  ;P@0 0S0   B     0` P10pp5X,0S$tD$ ? N 0 K0PP0T  B,,0 HS`P0T0$0T00$,0$X0T S,0 T P0 B, $A(0Xh"00 1PX.dO-P @$M0p( `X0∀BQ,PEpQ2 S,`P`H0@ Z@a o` T 0 B0,0T0P0C0R8D$`$ ? N  /P,QP0$0T00P`U1 ,  ?0T/T0PTP$Ѝ 000( @H/O UU@  po/ 0E?o  2 PE<@BG-P @M`,0X S3 Rp, P H QBT 0  B 0,0P T00C( 00CS0D$?$ 0 N P/P, RP0 P0$0T0,0PPE0,0 |   T/T0PTPЍ D0P0<<0@BG-` Pp֢Pl @Pr  t Pm J.J>8 D4D4080H4+H40H4440_S0, L 0   /P0 /I^I>`0000W`00 gPP]I0U@ W0 S goЍ(hPU?PS 9i%P@oW ] Pl#O- Pp`$0 0VP0VP0P0P0 0S0S /(@@DT@V 0BP pK.0F?o P2`F0CPP Q@:@@DW0AS0 R\ R S\/o" R 0C/0CO- P@(ITP0Tp% R" RP@D Yp ``T`@ P-$0P 00D?o B@D2 0-0  a^0\4 ,4<,<823A-@Pp`UPEq   BR 0F7353?0 00 0 `fPpP  R/y@- R 0 Ѝ0200S 0 S :l00P0L 00@0 01/+  040000yXy<09P640( 0SID0:@ @B A0?0 0?0 0_P00 _0@CT'0  (PPEUPuP@D0T?020 0?1100 0 0 00?0 0C 0 0 30`\400400!=G-P @P0$   T o T0 T  T 0T0h00h0TpP0(pGHUU T`` {&0E?o P 2PEHP 000A- Pp`$00P0 T  V(@V@DVP 000 TpP&0F?o P2`FP 000@0O-$M0 @`00(SH S S S S SXPP0pp0200E00,0AS PT  HXP0T  B0,0,0 S0,0$   0,0S0PTPų?0%PTP$ЍX S D$$p ?G 00 %PS P0T  B$0 PTP00,0VWWTs PP0p?00 `F%P0  BXpp@B0/p@-`@Pc'P000000 p@-@z,T*T (TO-$0 0 0 VP9(p N&P,P0010PU*0 01    00%'0PR'0S S 0<Ѝ0-0P @'0S 0껧 -?0@-M MPA> 00#+P P@#0$#+#ۍ Ѝ0@Ѝ/4hA-@ `!0(P ,p0`AFX0!0 41S! 81S  L1S  H1S  P1S   W 0S l 0 V 0S D 0 ЍA~Ѝ&4!::33"Bu3i3I3(3O-M 0p 00J0<00h<1?S10<1'#P0Sn` ~%p %P $4%1 %P z$<%1 %P m$@l%1 %P `$@<%1 %P S$D %1 %P F$L$1 t%P 9$H$1 g%P ,$(|$1 Z%P $PL$1 L%P* +& $1 ;%P Sn+`% \qWR JqU$pP# _% TuT XXa\%P L#0 G%@R>R 2K41{1T1.1 0w070*^///+3:]2/e.RO-@ӜM`00S " b$(0Sv 2S *RT" @ S$Ѝ @@8 t@r RT 0p,p@@P.K/U!T0 p0, ," 0,!S Q_uP S SP_Q S t!  $ 0& 0p 00N!@P{$@@db"0101SAOt@ S S@DOA S     @P0@ 80r s0 SR ^S@P P 0@ 80r s0R S{ NSPPv$  @ #oK,T,+L+*G-M `0F0<00@ [PR` mf?p Np0P  ^#P #"ptP0Pd  00`3C=0 )C=ލ*'i0dAA-P`d@pV# !0 -R0 0!00ЍO-P @5#0IPp 0`PV 00P0S0Y` Ѝ DRpĵ@9-/^O-0iM0 6@4 0(0 60,060004P("0400S] @p4`, 0P0 `PQ%0P 40`0/Sx%0 0 E# T 0E#P   40 ;R04000(00H0,00 000$0 00800 0<00$0000040P0 040 R,R<,R040000Siߍd P P$0 r0P00E# $ P { pP#0P Z40`p0/S#0 O0 E#p`4p#0 C"P40 =R 04040 ;RR ,R0L4"P 40 =R0 40 "P 40 =R0 40$ "P 40 =R0 40|"P0S00Xq"P 40=S 4 0@40^"P.40 =R`!0400p  >0 0 <0<P 6!0 !}<` R #2 7sH)"P40 =Ri >`l!#! / I"["PU40 =RQ >`l!#  |!P !P<0D09;R040T6(('''.:''&.&R&&v,a"bb$$R#$:$&#A-BM`@^!B_% P( p@ 1p  0 /  P0 -R0 00  P$ 00 >!Bߍ3#7"O-M @,M͍jƖ\jw p 0 P0 0 0! 2!W *G! 0 !6  $0S W Pp!$0 |2S 0 pP *s=00SY 0 y *6Spz p Y0 08  @PZ 6SdXݍ,Ѝ= 0-P #ND1""T!!^{  A-BMx`@`6p Pp L0 &6  $0 BߍP&O-@ p0T 0QU `V 0S ȱ42S0SZ  _Y_JM@ WC- @Pt㤄0U G:l2S I ,`Z =Z : Ѝ 01S0 $R P 0S 3/0`4V `4V  P`` 7@-P0 S AT @   RT 0= 00=00P 0@0000S  Ѝ002SC-P@  $ `(7pP $r0  )P <PZ¤ Ѝ P ,`  pP   o4 P   P   P @[@  $ P @xH@ e X P Z $ P  P @"* ppPV @   4j PP @XL  < rPP @X@@C GP=I +8} TPP @X@@% )PK#h 7PP DPX ,Pj06  PP @jX P @|@ j ,Nlf={=A[yoU@-M pM` MP \ 8@O 0 PRTۍЍ T`k MV@DyO-vM M p6]0P4` 00@*`M|0\F@H%H0 Me=U 800@0 Te=U S $SY0S S I/Q0ɕ#080 0 0SD 0d]S+$0HH 0f ,t P 0,d c00, \0 w@v=eN00 @ 0 00d++$0S 0$'0#R00S r,$0@T P`    M`=  0S`= 0(0SO f ,BN @PA 7S ! $7S !r>0 +6S NY @0" L#>C 0S Tv=000Sv=00@vݍ Ѝ 0 'S   /j5(89SS  S R@@,CK0 BR@UMCa)<@DScT@@@d8@ @M2ZdW@- ЍO-@ Pp<0 0800 0`P-p04 0P(00 1R[ X6S 200X0S00f=,0 D 0 8 e>0 0 R Ѝ`q@- ЍO- @M00>C 0C(0[X =,00S$282PS`>$7070ZE82SB[vp0SPݍ<Ѝ 0 Q P@P 0000 S1K 11P82[0C?o20S=80l@B : 6R8$&P ' 0Z Q Z82S0S 100S |%p0 02S +1$0x%00 $0$00$0R T0  0 0$500000000; 0 0 00 0P50D50J>H,,0SS |$p0 82S |+l$0 O02S [8"00R0S ,$0 >0 S7 +|#p0 :6S +00<000}8p  1P[PJ l(PFZX# 0 z820CS,+P:S[94"S)02R R#429029 S " @Z :Z> 6PP : 0:00 (刀pu:6 @ 0"(:WB  -S8 00W=*000 ! :[8"00R0S ?P0 C@BU0 >G4S0C: GAB:,0:S@ 4 GXA4,047cd$$ ;   D Go? _Fp@- @Z0&R Z |G06p@wGO-9MM @nP`7x< @0h<008j6&S l' ^ 9܍Ѝ^P D4S0S(70D4066,$06066R0660*2,06@0(060D0<*(00pJx 4b. 0;00?000 H  \PlP06B1,0,60(0n`7VS 8唶S,08[0S*  6S%% )l`Y:K?CcSW0ST 0PM l0$0  4H%0 :I= 8000 0z0 05040080000c96&S80P?Șl>0$0 0@ Xp$pG 04008000 0C96`4d$0Jn 08 $D P($(0    0 00Si EPoZ 0 $DPi#j0 t 0 sp| 0 d 0 ޾jEPA;0 0HPLjoL gP0 ; L|`(p8bH82S+DK0`000 `)<0 P2 hþDP 0000S  2 008n`( 00008P%0 0 D%0J>  FP068"R 4>S0820 |e $P082 82S0h$QP(1hp< 0k 0` :6`82H S0000P00Y00S Y:@ h┶ 0!-\ (W j c b  zB yN`ht:L_zp@- P@0I-08 `pp@-{M8Mx0 P`@+X I-@8 0 >P000 {ݍ8Ѝpp@-@PPPPp跱O-INMP ,Mp 10 `P @ݍ,ЍFNV.@PD(b0  ,!p 7A>0 T49H@P @x 0( I>080 0P0 _| Pp 0SL`P   `^ p+K0 pU m@|1*O-p $PP00P&RP Ѝ0`@SD$#DL#LHVT#0 @80 qs0 SQ0  ? 0 PFFC-M `MPp;F0 C C0C@@8H  Pڶ0 0 0HPP0S ܍Ѝ 0S S A0 P42S귱A-P @`0S!0 0S  R  FDv01 pW qNV01 PA- @Ph!p` ` V0P0nFo00? a 00 巨Ѝ@KLO-MM`@@ P. <` 08004`匣0  ƾP`l 4O~0 p 0 ;000qY00?S0pPp6 nX%02 ]P㓶 !$%02 O0P0 $02 AP $02 3P 2 H<`V&~ > l# ]P P$ 0 V`4"ލЍp0SY2 HpP4 In 103叞p0$030(00JnSC SR 40 0 d3`# 0 0 0H005P%0  0 D%00  $CPp`D HP00SR "  S2  L" 0 (0$ 000000050P% Sp00 D%0000 0  00BPo 14,0! p0`Pc04  !1 0   PX 40!pht PE 000 S 000 0 p.0S0t p  0` 0Rp B0p40C N`P Ho0 (0 ^00Pd  P `H`O!a+ w 4a O-M؀YX" .Ѝ`P0S P P0 R-0Sp0 R# H  R0S 0S 0 M000S M H0 M000B|!0 `*0  @p<g/0 <_/0 !0S0W0Z0[ 0Y  0 L0000000 00000 HS0S 0W0Z0[ 0Y 8L000 ]6d p@-R@00Q  up0lS \  0g?@ P/X4}L0 0000pxA-R P S`p@ UxPd 0P Ѝ@@@U0@@, 0  ЍAfRR0C-S$Mp P!S  D! H* 000 pP ! 0`` @P P"_CQPPx   `   2  E  F$`0 0 00 0   `0  +0  Q $ЍPVUUU0p@-sڐ @ p`P@P\  H0 0  0 00 'W0 0 @-M `@P 0p0 0@ @EV@P tP?0P @@D @ *P00 Ѝ?&p@-8M`@P  0S@8Ѝp0 ?P0 000 S, 0去@O-TMp`@ ᴎ0SP S3 S4>0>0 P h. 0  x 0|00 /0,.  p.0S .S S SX Sx @=0=0 SK SS S tS-0  bSz x-S Sh-0  S $P-S D-S  S_Uh0$-0 l000s -S -S_Ul0,0 0100b,S ",S| ,SV3 0S0 $0S- , P% ,l0 P Q\, T,S  S  BSl0 ,, 0 0Pw <0L@0 @P$0V 0S $0S + o᪢@T t@@< x+ (h;@0[0S0@ <1P<0 0@P+  : 0Sp000<@,0H100@0<0Q10S (0 0CS G3R` 0(S000 pYU00 R0) 0 0 ]Gs 0S $ 1$ HX,0S,000GhS(00(00000A$0eP $08)0 0p9000S40SH@_U(0   T (0@  S40SH@V 40|(0 00P00  x0$0S D(D P 0Si P@k 8 @ 4D H 0S <IP@\0 <P8<J84<J4080P4 H@@`0 0D000 QI0S@Z0D0R@0H@S D0S H0S  @P 6``00@0Vq +6&0 1400p0?00 S8`V8_h&0   mT L&0@  dP? Q !Q0 "Q@ 0pQ`ҙ Pڳ0Ͽ 0Pzp40Z㷀p⸏+ 4 0 `ZPap@T @P050% 0 P0 400 @S l-h0Q S( + $* 0@  + Q+ S) S* 0S @PTЍD$ @Ph00$0 l000  v_UVh0$0 l000  K_UIh0#0 l000_U?h0#0 l000Ph0#0 l000Ph0l#0 l0000S @P @Ph0(#0 l000# {0S S S삟䂟0S @P @ 40"0 00P00p" Yꐂ" S"0 _Ul"0 _Uh0T"0 }=00_Ul00"0 0100yp l0&R   !(0 A!0 $!0   *h0S!0 @0 @0B Ah02C0?0D0?0E0@P`! p%_U@ʌ Sks P PGY;PY?XC12/ TT%7fI vqt C  O-dM`<0 U @V TPSP0@,@SF0 $R" @p,8@a@0P,S; 2,00?P:020|"PP 0 0 PPp 0 z8"0P pb2@P0 020$00WdЍp10@p10100S 0@@, $ 0R 88P,l@h1 000 Rp`P @!Q@,Z 8 MZ0 0P 0S 0 004000$ 40  00S R 4  `  0 4 @/3~~^:&A.p@- @PpP C-@ ` PP X 0 p0C?op20$0000000 00S0   P000PS!P 0!0100+S ,00W pzQ  pGp0` 0C``C400 0CC800 00A A  B A ЍO-DM P@0 br #~0!@ 0 0 P  00040AH0, $9/P |# 4  DЍ 0@ @ 0,@ 0,@p  ,C8@0 a,)C@0 1`Vt,^ ` 0`@>00>l>>X> >0 a00 S` +SZ 04>00>=>0SR q 0S S Sh'>0 #>  >0l8>z>>`e>!o>z0: {{e>b>Y ^ @! ?R!0q}=>===0@Sp`Sa2>/>,>)> 8 FILM1.09FDSC STABcvidraw 0 p@-@P@AaAQ    R0s/  \\   pQ Q Q \\d  +\ \P  Q@    p$   )'6M 0p@-P0h0S @`3/Pp 01!2"  pp@- @`]K00@-P @`0S! $0? 0 0Hu0`7/`P D!$0   Ѝ$! \0S95S `)D`%D5` D(0`  D5 (0  5S l  Qdz0 `Dp   ,0 p ` S@`C2 d ) 60BO-0 P@ ҕPJ.PTJ>  D4 D4# (5(5L5L5H5H5H4H40S0q簐O`P3   P  8 80 0D D000000 S 0L L0 @@ b? P   T?P 00 tmcdA-CM @M`PQ wp08pS g  $0 P  < CލЍ0 $^LP  4 + A P  ^ R `XP M `OIPtX@T4@@ ( 0  vixM@-`  PP @ @0@@;Pu ЍpO-0-P @DM0 00S00S0000+R0% xpd 0℀0R0X0Sd%  `?Wp  0$0P H00 `2,V000`VP| $00400(00 Y ~ P R$0 `|$ `  V^DЍ  `P0$ 0p m | آY  BZ0ix   z  ax#  z O X ` $ppP G00 `V\P H$( 0V_` ,V000# ` # V$P \0s >|P0$7|P 0\0,0S\0S `P\0Sp" p`X`L P0(`,`0`4`8` S" 1@10S0P0S5!0   0P!0  ` 0K( 0 R t!  @r0V! 00Pyxxy ~$60P D ?o20<  R@!~0 00E0XO*0 LO`P E0 0 EU`P`P0pS. 0He R $006/`PH! 4 l0S T0  nx!x0  U` P !   `PZ V MZR 0唀R ?02"00(2 0JVŔ`P0T070S4S14S04,00 oL`010r"0(  zPlb O- pTP@U9 0S07 S5"0a0尠1 ᰀ P008 0`P 0800SgP ЍK< P   =<P 0SP Y00He0 $6/PP0T739@-PM@QN(0T( 9@Ѝ(`<1pW"Q W "9 @"Q99(0 0 q0+S @`000 ( Px (0 ` ? ^^10<08 00,0 0RJf@O- @-pWM 0S `PjV `P($ 4 $0SY ,0S\Qo8P`h `% M> 8S(5Sh0 %(,05h0 5,0S  S`&(05}{7`P5 XЍ0\`6h0,0h0h R\0X0C?o20S `n?`X0S  $6 (0 " 4 <000t0S l0 xP 0VH" l`0M.` ;N>␺( PS + p; `{:0 (0g0   0 01001000S00YD0  0  0@2P < 0 PP$0 0S XD0H (0 PP  +N>< hS ȋ; p `{:0<00  0@ =3+3rq{qSR@-@(Ѝ   (Gz@-p-WR@M 0\ЍЀz0: s  0 A  (tFeO-0 @ -a0yMSA 0S> 0P0S.,0"pP QڰC:P(  61 01!| R 0S1 ± 1!>0! {0S  R11 0.00S (0" 4   0R000000yߍ0 R؀YX )P 0484 0  PzN~z q0 A (0S T00$0S P \!0X Z  L* (!(0   S BXz0 0N~P0z0؀## 4堋q0<00@0<00 A0 ( kO>C|0S0S700S40S00r@Bg^ofpfA-P @`Vp  Q&9pP pPWp4$0S `^U0|OUUSCPp,(RPA-@T0 0 006P 0P`p65P 06 5ЍDONE 0p@-@1 `P00Sl444 7 C 0R pSsndDvidD0O-S\@ P" o Ѝ8 `(u744U P 0PPܱ0S#4 4upr4pk E7  A7p` :70pX',100r60P!  0n4z4l4 4h40^4?  FPX000H60Pt  h0G4 S4P40w44t4Ꜽty-_TXT_SNDHENDm8_VIDO-iPM848@SD$张Ḱ (R  Y PT0C@COq840CTЍD4 0Y0S> C :@p C ( :sVO-M M#80@$0 4p P$C# 4 `$0H 0C(0`0(9/P h#0 k ލ ЍD4:0 X,00,\hW 0Q YX4f:W 4_:4[:0S  0 4Q:2 0X RVX0 4 0 0OD4<: 0S ,0( 4 0:`X0STX0 4 0 004:4:45(pSC $1!8^D$1N1+> C 0 Q` x ! R ,0)")L40 H$ 49,0 01 0S046#9LTPhl  H40!  9`IUlO-M $M@p4p 0R `V40SW`4p[0XdP0000$R '0 0`00 0p0!P5  0 D50J>n.pP0!;00$00!{$0 pGC  85$0 R{ T Ux -.$0؀G CPHU"0 5/pPA]" P X0"160 !"R000P 0Sp pnRW0 q01  #ᆎ 00%Y 440 0#F 44`P%`E0 0Hu0 7/ P F`k0pPX$0 C!00Y<$8Q  ! D <$8P <$8$(P +FG+C+.B.B@$8D( 8ą@$000654P50pP0)5d4P|Am G `000355,4Pm$ 0pp3!P0a55p 030 0 R0$!X0PPXPUF3[ 6 +XoP p 0k3Z5pV5)00$^3#`P0 q2( 咃, 哒)0 Fn 0 "p ݍ$Ѝ"0 +0000]0 0! 4" 4 (" 0  /pP pE 0H9/PA VQ! P0ʠ 6P  3! R?!!R0T37Qp R>  R;0X$P6(40S8$PBPE PE QU$`RPD ! D  D Y8$D B8$!40S  R `$moofmfhdtraf.uuid@BzO- 0S`P 0SOeX4@ P, N,! K,P 0S P 0S I0>! LpD84W! PD=Dp80@-M PM@0S 8  4  2 Y ۍЍ0 0 O-Xt$M @,PSR$`!,0S 00S$,➪!000 00С P dP$0 904S NP $00$0i 040040碐$Ѝ@BA-i@pPP ?. P  9.   ? LR LO- 9BP 0!0H0!08 80 2$ 00 2 000. P ,p ?\"\ 0   [IY10!0 0 0S0;!S 4$(10H40 000p0 4000S4 000S 00000S 4PL50 0S5`/FS,10 $! 7  4S 00H40T4p0S0P4S00H4b1  00L 040Yd ; -: DpePV%P++O-,MPXIpP`4S ! C*! @*44!;00 CVPb 4`<8ĔL \`p4D4炮JV0T 0V0N4() 40100(1 0000 ! J>     #* 0S$`$,Ѝ0  0 ! J>    * J V0( P J V0(LN%`C-`T0' 0 0p000/  P@0 R0" C000P/ @0R 0 .0 00/ Ѝ.0lG-0p @尀0 P ` `P$!P00000S -- 0-z 0+S-h--V  n0 El- Sx-- 0-z 0+S-h--(  :.SoX XoS.@-0@R0ʎ0^A\OAC@\O@C@\O@C@\O@C@\O@C@\O@C@\O@C@\O@C0?00 00400; 0/@- @(,@s@-` @0 00 1000 00$0\03/P P 0 @@PZ|! ЍpS X0rG Y-X0C S-X0? M-X0; G-X0$ 0R  @ (P    k  /  00SX0 "- , 0P 00 000-----ꀴa0@-0 @0 0R! 0CR  R :000R 0C0R 0R c00\0x00p00h00`00\0\P( UP,P( (P*Pxt O-M\4 D,4<Y,< `8pS |S8 t#S> l# \XS& PS0  S1p P0TX0ϿP 3UR\P0S1P[ U" w\0$00  S1p P" Zt" B  g P  P  P0 4" 0  PK  PK  P0040 0@ 0S@0S! TP0@0 f@@0S P T R0C@0#0 0 0C00((0S  pW PA-@p^P`P0UDP"RP%0 R@07P P0=S0"SO-Mట`@p  pPU, W U U E Eo/o"0 `V 0 @SPD @T  @ 00D0` p3@ЍZ-M0 000ЍA-RP`@spPp P P P00 @0pX P PTQ귱pO-0ؠ`@[!ZSR TT 0 P_PT*d 0 ePpG% @D% % e(pp' @-R 0, 0 D 0 8=I_s@-0P `@00Z',@ %Ѝp@%Ѝp@%A-@Pp`UPEq   BR 0F7353?0 00 0 `fPpP  EA-0P @00' 0,@`@p'`FC ??l%F9%0 00'Ѝ>V <0000, 00$0 0RP%O0C-p `P@00S4y0T0X00S% 0 00P& 0Pp&$P &$%! P&$%0 0?& Ѝ010 R 0pQ/Q0a0 S0/A-` Pp@A =00'p  B.UH  ' #  VP    Ѝ   @- R 0 Ѝ0200S 0 S :l00P0L 00@0 0   040000G-MN`a$ p;p0>pP0 0` 0pm@ R    0   B&ލO-IMN~ `a$P ;0>0 0 0Q' 2 /  } y u Pp l h Pc _ [O0   B&IߍO-MM P@8p`p p$p0SO80S0 p4<0Ȁp40SvD 0 v` X&0P  80S 0\S S ;## . ? 0 ?'H`P0E$0 00 R4 R # Mߍ R40P0 |# 8 R\# Q\Q  Q R <80pw # l *^`#0 00$ _pR# ZE#80Sj 0Sgy~;# "A0",#("' ; ,0>$(0 00l h d ` \ X T P   i h  < 8, 0$   B`%Q4PE  0R"- 4 "l0S D S Sh0S``8" 5"""'0  ( Pޔ3T0)yO- `MDP 0 @ S$#  0S\Spp$pWz<" 000$u"0r"4o"!20 0/$!6!X"U"($N" $!={>"$0$09" $ 00 040S 0P 0p] ""\1 00 0<00IЍA!"$!S 0S/!!d$!\!d! \$M !!'yrP;4 0A-1`0S+ @Pp 0 S  #0IPڀ  0 0=08@T0 0 AԌ0/ 0R0@-07@-S@P 0 00/P  0S 0 00P   0S 0 0 0 P h  $0S0 0$0P (  Ѝ0@ Ѝ0&ʋO-M MP8p  Un0@`(0(T3V 0>0 00K 0 p?20P0 $0/0CS" kp[?~,pP- X`" 0 P 0 ,0,0S00p" 0 P @" 0 P 0 "S š 0 0<00@0$0:0XS 80080P 0Pp f!0 p ލ Ѝ `0 S 0S$0?00S0S! (勗P&00(0 0O^P(T`h(?V00SQ SP(0 寗P((P p' [D0@ 000 @KLrbъ:'tb9b]z@@-0 0 000P `Ѝs@-P`@ 0 P 8" 外P Ѝp`껰A-`pQ 00|0x 00p0 0i 0 @PP 0 PPPPOЍ8vf#0s@-P`@ 9 P `" VP ЍpA-PU` `@V `0Sp*(?-00p0W:A-P @PM`p 01%00C00S  PЍ0Sp 0 P@ 3@ 00 p0 0P00ꪆnA-@ `pP0T:   P?U00SP@O-M `0P01`@000U:Ѝ0 0Y X ~ P?T00S@P 0 Zor?0@  1 0  1瀠 00P00 @ @ 4 0 \ J?@ 0 p u p P 0 0 0 <~P O-cM0p`80 P 04<@DI@P,,8nyOÒ.q]e e vU~0~q~`~~O-,M4s $@ Pp00 $0 0`V}P 00020020 00V0:`p0V* 0 v`P  $ PP0U: P`@0T: {$v `XP ` `p 0 0P$0   P ?P$` Q 0(t0 p  480 W*0 1 0P00 0( 0 R0 0 3/0 (p Q Q 0 SR0 `g$,Ѝ t$Pp  @qv}(}5}?}{G-PM`p@PP#  PPĐĠP 0 0 0 00@P  0 PP@Ѝ 0 H@P @ @P @ @zzzozsz@- @"@0p@-S `  p0 P0Q   R  Rd  qXpl@TL %# ! *U0 @,-pyP,yyC-@ PTMp }! N P`V`TЍ  k$ ;0@-@ `0pP!pP0 00V R\  0Sh$lY ЍDSt*xp@- @P`0PpE  00 0?QP P (  p00pp_w0/@-P@$M 1S 0`00&0S 0 2pS400$  0881000 0P& ! 1S 0 P  0*%oī$Ѝ2 S 04 D` R  )  ``P  vvuA-@`0S$ p{PU:Ѝ0S P/0 `!P(0 #0 0S 0  %PP  ,  RPP~PPeO-P0GM`S @` L1@pS.+H1TGߍ0 S)HD1 CA? 0 0 1PL1S ! D`  @0X  @000|00 0P L1S  t  PH1U0S P 0 L1pDAPS '&ssssKsO-M@0 0`0 SM PpP 0 +X`! p 0 AmUЍ輀XY K 4쀟 0 wU 0 qU  P /nX hY 0P0 P0 mP -PouPr@BG-M@pPL:SPo$! 00 SP $aW0S0(0S*  `00& `0(J`VC0 SS 0c07Ѝ,  0 I(|q00 000 00S    7PPEb0 SS 000c{0 o@Bz4plVp$ooUohnTnG-pS" 0S0 0 a`P @ R 1pP  @TP P 00ЍqC-KMP(@ `P P00<00,pN(PP0 PP  X㬀+ڍ? 0PKߍP P &P ᰐYP P 0 0ᔐ O-'M MP / @0(000 0SY980xQjQr0? S0:P `+0 P '0 8!1S0$$0P+0 P '0 8!1S0((0+0 P w*0 P j *0 P ] t*0 P PD*0 ~P C*0 qP 6)0 dP )()0 WP )0 JP  T)0 =P  $)0 0P  +(0 #P(0 P o/ᅧPY  (0 P 0 00!0800?"0( 0 0  B + r/  &1?SS{Yf 0S 0S0$0 05,HS800=0,1 4P`L M`$0S^ RSZ0S 0 00DPX 0S 0 007P & 0 00)P & (0S80SA, PD|& o/ئPLo04o/Po/ƦPH P0 $  P 1 (0000P 0 , ,hP 0,0 0 0,C0 P; % 0f0 S3Y0 40 000P$ 0,0 0P$ ᅠ0S ,P H$ m 0# 0002S000! 0CnP# _|2 S 000 )0C[P# 0 Z 0 0, 10M?00PY1S 0 1, 0M?00PG2S00# 408180000#P" 2 S40D0S  0 )D P`" 40 000Pk0" ("040 04 S[ ! TY` ,0 0S! ,0 P0'ݍ Ѝ@؀SP h! 0m P 8! 0`Y ! 00P  !  0J  0 P jj-#je-V-`Fhhh}h++x6Gf>f1fdddc{cbmbxWnbnb}bgbSbb,a0 0 /%/VO-P-` CMM0@0&  010P Ph$ dtpU U\  I4 80R P#*0PECލЍ`Py0 0H0D XD PP Fyp30001S 0 0EHpS0Spg0؅Wspg0Z P] 0u 00`P`Lp+PPL PCURP ᘋ9떚Y@0 P0 S7Kb2F] 0PZ( 0 M PM 0 0 PR(Y 0yM0PtM  B00 PR Q 0dM0P_M  B0 0PS z 0 Izzz LM PGM 00C 0PS   0 H{{{ 4M P/M 00C t00X0T 00H0 0_AOEc1ccqbcb&maMa(af_?^/O-M MP@*UV `P /pPڍ Ѝp(1`00P  J` /PVİ  UP P    GlP P P P     p`jJJG-(MP@  `LPp0Z0 0! 0 V 0S !0 0 0 0H*P.0 0 SH O HK FwX| 0 W :T00 0QD0#.(Ѝ H&\\ TS7O-M Mp@P*`2X9 dP* 0/S'X  `,P 0/S00 /P00    ?P0/S   ڍ ЍX  $?P000?S P2 /P /00Y03S Z# Ȱ0 00 ZP Z/Z P` D Z`@|:2E@-H7P 000!!""##$A0@S 00@ Sa@P//O-`P@ ЍJ 6@P %0 S%P,Y)0pPP pP AA0QAG P%Q 0'9Uus0@W@9S0AWApq020 00 p+0@Z?o20S0  G-P1@S .` WV UT S T0 VK@PT  s00 DK@TPO-M 0@TT@@2 0匀 S<RALP`qT SR  B R 0LP01`p ͱ@`WV) РР V `/ pؠ*+ ` pؠ V ` pС ` pСZ   r R˰j @0TЍ@-@bP(0`3/T0  Ѝ@Z ЍA-P`p0S0A2$ R P 0 0R ]p2 PP2$pPSR@-@(Ѝ   ܤe@-p-WR@M 0\sЍЀz0: PK  0 A  (ꀤ/A-@T`P p P0UP h0S PP Pe,_}@.b8 P AO-Mp`@0S 0 C RXЍaCqQ$$2 !VR  RA dS1 VS4 aS7 B403#003 0QtS vS$ sS0 Q :Q+R q@R@S 00 @0 0 0 00 pS70:S 0Y @ R   0:STh   l4 1P  Y@x ^  P@ R0 #SP iS0:SPP f0U 0ST@@DOoBXmS':QT PpP GhP @E 0 @PP WP _oR@@1uS0S 0S# S 00T  R@T @@l0S h0S0X1S \100p`p@00S 40S0\0S `000pp S1x P @P//0S p4S/0/t4x4<52 0\S} Qy 1 00/S- Sf Sj\PBQ 10dP 1\ :LSQt1\ 0<0S `p Q H1008100XPQ10\PQ00S.!0R\)Q 00<Pp rQ    0D0CS80S80S P Q`00X0\\0S //UOO*PCPNNNNPNNUNp00S0S 2 00SP/SPP/H0S Q 0/0O-Mq@ `2 0匀00S\ PTЍ 0Y QP00X00S@ L^ P!ZP /1PR@L /a?@0CS@-(M \  ( 1$0(Ѝ0@ (0 <6HHL @-e`fP@T_00#T0  40R 0SaSSSmp4vO-,BB/C-ET0>0 00  `@TP T0%R00 0S 000PE0 00 @TPT0@P%R0 0R  $ 00 l ЍAO-p@АP0U` %R0` P` `P    V PxU$  $ PEU R XB @KLs@-@P`0 00000G  Ѝp@0S@-@Q 0, Pt 5 Ѝ0,0S P E! 3/P@A-PPp`@P P  MPP \PP:0PS@0H@@p@-P`@`0Sp0!00  40/Sl0S0 @ 0P Pp?O-@DM2PX`h 0lp“" L0PT 4000 $ 0 0 \RPP L0S T 8<00 , @ (0 0000S Sh DЍo0rS00XX000f?垃P 0\#\02 0TQ =>0H1H!00@1 0+! ! [ $ R Q 300 000 0? 01!"02 0T0SppW0002 R /2 0X1SPÉ00l0)7D=6<@-P0SHĐO-oMH @0P 0ST 3aWV/ WV*> SR V2ե02ť  Q+` 0202"2Q 0"ũ2*>"2S QP 1!H4ؠ [Z 1!Y 0S2 0 R  2 00,00, 0X0R0080S 00S08080[Z<0* !SR#K `>V" FA# R0Z0,R0P 00 0S A# R0,0S" SR8 00QP00 )0  0`tP xnP 1!c0t0p 0hp`00 h0VL000@d `\d0S ``V  l0"YL`#R$0 5`V R V `P ,SR#< 1S̈У p01WNo #(0 0UA 0 { 0P R SR00QP0S0Z \\pجh[Z| pV 0P R* SRSR0 0S QP ,S6R QP0 0S #02 00S$# 0`PQPQP#R0C $ ; LSR,  SR!PQ nύP,y  LH0, SH HPbP  !i-PAC#SRq fo I#^o @!Vo 7 #0 0$ Y 0S R ? # `pQP  0 !SR QP SRP00 0S800<0T0SS00804* x`  ` p!` ,800$0,0 0#! 00# 0 <0z,0S X0, R00S^ 80S[ <0S !SR-!$00! Y!УSR,!0S0[!ZؠQP2 0\`R࠳^ R0 1 1,QP\R 0SR>z SR00QP00S>  0[!Z ؠ- ,SRPQl 80S$00  ! ,R04 ű' ` 9 ` p0!Fo ',0 00 00,00<0 0 R$00$0Y.$oߍ,;69e9s8L430O-0M`@Q 0$0 @ |pVYXY 者 `` `q0``` `"!##!#!" X $00\0 D 1! 0 #$00$0\0`FS PZ 0X RVP@l (0SXp0# 0'0 R2 0X1S 0<00008 80 K0$`0"$#%> 'd00dS '0S, s R' 0S) "@ #  0@ 0 $ %pPf u@GpPnЍh0,0l00(0,0sdd00d0 p@-@`PP ЍHpJ0S/$@-@ 0 ( %&@-P@T 60d0` 00T0 0<`H @H0 0H0S0ЍpA%\,@-PU  ` A00S000p;0W 4^2004^ 00\0S @US0l0S20pO-Pἐ  `0 p R Ѝ AP 00 *. \% Qb P ,`R %0D R " !G-`p@ TЍ0Q@0 # A 0A-|$QL0a##V@#p#0#*.,@VʌA諪QG-0  p0#`A!CR00 A C\00\S / R& "  * $ SP@@å@ \ S@T@C $@TV0 0 0S00O-0cSD ЍWV\ @qYlQ@T\Q@`p@ PP 0 00P[ ⚋$ # DP0700 000 0v @ WV V0  B  #H`  @0!   #QP Yꩪ Q l'@- M`p#@m@0`.0<00800cbw ЍЀO-lM@ ""R0 980X3T#00H3 0PP,#  000`0T000[!0` `pR?000V 00S "(` Px " lЍO0P 0 1000U [ 0`p1001<0X0L000P0<0WP04004 180 !0X01\0L000  R!X?01H00 H0V,01 0$0 $0`0D1d0T0P0 !P0! P0"QP*`804 $ R0P ͱp`| R? | X0| R?  | `P PP <P<lЍ&u&&&@B.Ij7O-4MP @b P0"Т0 Z P0X0b0 Q`Pp" (" 0"X0 01  QP b"R0800 00t0 0 0X04Ѝ!bV`0p0S`T" ]x"O-YMP@$`  $X%08 > SR 5a/10z> QP  > R0 > b?Ѐ Yߍj? SR1j/0>UPȟ>f j? P >P0 4P0p040t0b?Ѐf? X01>Ѐj?  > >03#003 0X>p $ >p I j? @$8 p 8>f R 902"002 0bUРf΍ЀjR ЀP R 0 ЀP ,؄ P 'Zn.1pb0'%> %%Sb?R PP& />|  % 0 ~ j?}  l$$8P8#f? "l0 0%!% & t $[Z  Uf? 00b 'fP0 0'ͱ$Z0' fύP j P b >P"9!w! 0 eO-`QM\ЍhP#@ #X"08 R0Q1S 000#0؃1ؠ X SRpT X0| 0)T0!80 X00 000#1P 801!00t1 0 PP0!ਐ0  p0P E 0 $8 $  \0<0 $p00`0,00(0$!$ T00X00#P0 g``P0aU&Yq 0$qPf@-<0S/S/A-0P@P`P0 R@pW@?\Q P @P /0R/0@S0 P$ R/00RxB /P TT0PP0LL0H/D/     P@/0S/^000^P0S-@- P Ѝp@-P@@`T Pp^P ppp@-P `L0@@V @P  @ 4`pp pA-`pP@P U@ , 00 00T@O-@[Z- SR,MP R 0]1 ZQPU2 R ! 2  9z  Z0z 0S 2 A"(| P pW  ˶x,㑛` @ᎻI 00 'J1Y@!!  P0!P0   0!@ 7Q' TIʴ0Z ND@D  `*$ ۸ - >[8 0$  R0 A` ~ pqcM0@@>+=c}(00px,:[KKZJF Q;C K;C[[`0W! R` 0 P000R /[Z,Ѝ _Bv@{Gz? _BO--P㠛M0SЍ0A00S2 P' 0 R#`ȟ ?!}/" 8P0P00S !0 0 7#kp 0`00Sڤ`V2 pP pXY0^ zz 70 A +,L+  ໴RJzz 70:0 A + ۋ ˸ ۴<J11۟1 0 2=*;S+ B Z΋` `  Z 0d    =c10X H@{Gz?@{@& .>{Gz?>Pp1WV Y jU ;+ P a; Z!0 .0  ?D0S-\* 0& "R0"`Vz+z  *z+;a!a7j 2 Aa8ȋʋh 0  D0 0  P v@)\(?p@-hD\0pl4 1Q QP  `aV ^O-0@\M00Ps 5[ (0  Saʸ1S U1S  p %(00(0\Ѝ0003/pP+`5W w[`` 0S0q0S1SS "1S c304$004 0G``Pp$0 8` !0x$0 *H4  T$ "8$  0Z :{304$004 00 Ё a1Y">X ؀SRo0YX00 0>R0Sd4Sa 5 P0  ?<! R0 0 Cr5" R0!R0 " R 0!R 0 P q0."QP\0YL:1s,dP !@P,P ! *4S Z000140000 [1S 0 }pP> P0 1.1.1  P #SR @ #SR  tP   \ @# 5 (A(1S~zꮺ  \n @BO-AM0<0(8P0 0 5 `V  TPg z 0SS  0S $ %ZSG<` @0<Q 4 04M0  4 @ ` @ p!$0p00#!0& 0 6Z@0S= H0  /70!0S 0S 0  `0 A2$Z, lP 0 2 0<`P 2 0 0R 002 P AߍP2 $ `WV& QP00V 00S @ 0 @`` p!70%p 0 /4 ` pt `! k!$000#!0|$ 0 0S 0SH4 0P`:0$( 0 `0S 0S9 1 0 00 I $``F !SR 000 00! #$0011S0 10S00 S00 S0:040/S0  PC2 X1l0"!\1h0= C&00``V 0A> "0v SR"q  D2R004rpl0``0 0ȟ P  0# 0 `p 0R\P@ AV;R\ 0 0.؀B `<   WV R!   0P !0 0 0 0 1"012S6 0`0 00V02,0 0㘀 P  P  ` T  ߜK/$$H4G- M`PF 5 R  P@m Ѝ 0R!zP0 !s0! !SR!!HpW1Z3 SR00QP00S' #"p@PaW t  5@T !SR!p 0p1  B)2 SR 5p 0 SR 40/S!SR0 0S  @00  $0 0q<000 00! #ЁpP 0dp` 0!`P0k@ 0 e 0 S@PZO-p0`dM@H PR 8 R`PP  0 1 dЍ 0   5Ё/V 0PV 00 0 0 05.YMP0 1 2?`p080S*0< R2`0 0PP1Pu 1 V0Pn Q?~9002,"00$2 09<0P 808/P -P 0 *P0@[ 08ZV0 1  P P0 ?0  0C P0 . y p P 80Y'"V0#<0 P 0PA 5!tP0Z0 ڰ  R T  9 P 0 :/P8@B5P*O-DM`!'Fx"!T000P 0Sv0V~4S0H0S> v*\'0弁8 <0`004`@0♈ 2 000@PQ0 00`H0@ H@!4/P9 DЍO؁" T  R0"Y0X p pp!SR"UT00? "p YX"́!́!lP " Y0X hDЍO^DЍ@BO-@-0`qdM<0H0bD00< S"SR V0? PQP l1zt"( z Yb"SR R0"P? QP O1z"( z <"!#SR R 0#f Z0P0  11bz!( z У1W V C>`C!SR hĔ\l4"SR RP P0RZ ^Z0C SRP P0C>`V0_00 Aላ  (W01 A!  0 QMJ1DdЍ ?B.AC$tI9@B0< Q؁0YX00C@0L 0SI 0H0L0L0D00 @0STP00`p0P00ЂT000P00  QP P0? R10R000S ! 0@0S4!R 0ͱ < P.ЂYX 0X01P\0`0 @0S-Z0<00<0!R0!ͱ"ͱ R10P0"R 0ͱ"PSR00S!"#R 0̱#R0ͱ!R0$! R0RZO-`,Mp0CP 0 0000 0U,Ѝ0A!SR؀KYX 0p0 4ЀYX 0 $p0 %P@BO-4M$  ( $ OS@@T  P0@ @00 $0 8R ` Spp00p,00VX0S4Ѝ 0T(01簰 R!, $X  R( Rh R l R X R  P  00PL1UP`0  Q  W0GoS0 0S ^S ء\ Z0 S0 R S \T 0ϠC^ \ 0 @pP0`0 0 00 0 0Pp0 @Q /P t%/ D R /P h%/0 A-@0P0@`""8 00D 0080D0 0 @lPP` p `m0V``PP! 㩾P0 0 0 嗿P 0` 0000V˿P@- Q Z10x0x 00p0 0(0A \ [10@0< 0040 0A ЍȾp@-@Pp0S d0S %X R 3/0S 0S P 0S $0S P P0S&PPh4S&F0 h4Y W4S C$( \ PM = `:E`AB?p@軾Pdl4a%l4P -l*4 4p@-`Pp@TpPU xdP 0PH4PP $0S 40S 3/q00p@P- 0p@- P`8h0@ST H׾@P FF  o000$0 1`#@#"pl$!0V@*O-MPdЄW V00V 00S@S"T (㟾@P   7p0P 40a@ @` Ѝ$!0 P@S0 R h  q R p Sp R/p@-lA^ Q  P@P0   Qp@-'/0p-Ϡ,1# HA-0| `p-l 0@P-H A0-0U T`p  @BeO-,M` @ PP- %P0 0D HSĵ@"#00C0@ \%P dPP  pY0  D R > 0@ Q00,ЍQ@- ЍP/-MM 0 ۍЍG-p@0(MT`P 00{@P P P%P ৾(ЍUPW  0SH40H4PP VPUP᣽P  P y0S H400P+  ẻ0`P0 H4Q0H45 01P0 4$ PPQj 0m PUD5TS{ P5S 0S P QPP QvO> C00|C>C0$PxPH4 $ 5R`` `V 0$PeP _P YP SP{yPP _yPPyPPq040S] 3/Z M1P4 HU05/PPJ0S}%00  j0S P} ؼPDy30, =P!5 ௽P&P }ꢼP  00S~ 0 L PPv  0L!` oxq0,0Sp 3/PPl`0So !  `yf 0 v oxPPH4 P U! 5 ( 30SW R 00@P !0   A]l%&O-M C"E> &0P# h<#<0  "00@P22P00\0P 2t000P ? "(0t0,00(0P0,0\0P 0 000  p  & T" 0 ~@p<2%0800\ Sap0 '0X0Jx@P_@@0@ S0@ QP0S0@ R000!0  GX0 0I e080F08 Se&0 00]P@0P@P0`P yP0:\OC> SRm FR0i 0`\0t000h0P00\0^@KLMb@?{Gz?v@|ha@KLJ]6|w̽3 1zj%P01mtWK@B+߿1a0A0” PRRL RL  R   RH$ !R帶0Pm S00 S0:02 R 50P 0d1 S2  հ0 200!S`m 0%R 000S00 S 0S  UP"0  ZP1S Z 0S ;Px2|" 0%> 0=00S 5pS 0U8 (0 ,0X0@0SuP 0 00H0X  p  & 0# 0  ߍ !0 t#0  3 0&R0MH 㤃P@ɳ0S0qa0<0S00 SUpp0  PP Pz `z ++(ppӡě00P\ 000  # 00b 0S D0S0\?o20SG0800R0S 0S< D0S ,SR00 00  40Sڰ00S&@00@0 0S 0S P 00S 00'R0) 0 0% U fZP`0SX0U01 R  Rʰ00S 0坶P 0  <@^_ , p PDV娦P%^ P0S*0qa2 P#0  P 0S%1R $ ઴ 00ST -P0   5pW DP  `@H4@0   0P 0 5P0 A00 02 0Sp m0P 02  1 #QPX `VUڴ%RSR \ 0 ``0(0 0夵0ᴐ#eWV( `PZ$!$/0P#$  JV?#)SR$ !0l)`0 0u0c$SR!$%0P`0X0S 0$ڴ0b009000 ᗴD`V"0z ?)0Hp㸐0ؠ` ၴ$P0 0p0ࠍ` q$0&X$ڴc$SR ؅YX `Xp0Ƞ̐ SP0 0РԐ G0S"p00St 0P \0P  + ( H4@ ^M#"02 p00Sm`#WVh V0QP \] V0b؂` pR`pb0SS RP p T RL$  ` 0#00S! !SRSR00 QP00S0 8 b 0D0S 0S< ࢲP!0 0 0S 0S p0P 060P 0ײ-b"`pb`pP PE p30P 00r0P 0 0 d0P 0^⦲  P( 0D R <0>.00> 0!뫰 P@80 80 D 0DP~ 0 0!g 0!H t 0DX #0P 0P/S s00 @ SR00001 H4@ ^T000X00X0vį 0  ֳ08 A2 P0S0 S0S 2Sp԰`ᚲdp0P`0  DX"#0{  ?$!?`#pfR0 ?$!"R4 000?L D0P0` (0H`⾪p,0忪!(0˷)",0H0L,0D0 ", DSz:z* ہSR 5d0S  ;#qaNAY {kqỴap WX !0 P.0  ?0SLTP  `.SR !0 )  02S 2S \ `0P! +.18@!80080S2S凲10CS <00<00 00T0080  H `@Q0V:XX -   Ȳ @@)`PP04 Ĝ)V @0TY:FO\C~ 00 G`P` @ P`/0PA $<08$ P1,0 00+0  ೰ 0S0S 0 0{`Pp0S4C>P Z C`@VqPRRSR0 @PB4P00=@000UGP0S0A2 R 4 0( 0P 02` X3Vp2 02SX0( 04 ʯ0P 02` 0Q \ R\ ` `  dRLL DT T /"R (P 2 0""XP0 ddhP#hP#000q!SR ,SR00s 0  ܱP %00`X)0T  P 0$   ^$ R0R#0 0#ͱ00#Y IJ] `0@0@ ?R0 p Py@ 10@0 SRd 0!A!SR,SRY #0PV/0N 00X1S 8!R ,ܯ#`p Q0P< V0""R0+"SR" dVR0 P0<`p?h0l0& "0#`p& V0` p?]V0""08`ᘯc&0%xl R0Z8  0 1 R"SRZ00!4 0Q Y&0  fv3`p@Q0X(*0"SR00S!SR,SR0  0  ذ0,,<b@Q 0 1"SR.Q@P PpġPp)@XPT@* 0\ F F0 P 5!RP` VX P$  0QQ 008Dv`0a0S  ♭!YN_ Ꮽ"O0 8 6@0A2 R  R r `!  ŭ0P 00P0 0 "M 妭0@  00 P 0"ꈔA!SR!"0`q 0111@0 9`p00X 1W V! V`paP1 U !R000P 00S`p 0 T3 p 0 P 0` z 0 00Q1P Ɱ0@02 90⧮00V00ri }0dP 0@B`HtmcdqJ2 2C-MX 50d1`!00T1 0a`P{P(! 0 A SЍ p.@P 0 j@PU 0  R  P0 0|000t0 0٬@P D@P2U  @PP< 0P( @z~[&usO-dM⤁0p@`VP H  S$0 0 00000400 0ᜭPP84P DPUMH )dЍ00 R @PP3 40 (@  00P00P400P00 P (P,P"H  ` 0R 0 4  (  ᦭ Pj 0@-S 00 0HE04/Ѝ@-@Q L53/00@-+@P 8`P (Zo&A-p0` 墮PP@  ح@P X 8 0s@Ѝ 0 @ր@Bέ@- @P ৫Ѝ"@-@p` PP   R \  L ЍpV0  40 QT7@-@PqP0 S:~ Ѝ0 0 O-0@LpMP` 6P|ye0jSjzz! : *ZZ+Z ;+ ; +; K;چ +Z>J + z; r c r +7J1 R  RL PR00R0S y0#P0LPD0SH P0L L P?P]ЍY0L000P00T0YL0L T0L0P00  PyP0S z * z+:; z a  ;ZL0L T0L0Y Mb`?tmcdc0 L0/7@-PQ 60H0D 00<0 0랩@B T+ Ѝ0@薭ɒp7@-@T0 P0 00% Ѝ00S $ p@-P@ `B? 000p/0p@-0@`0GS  ̬pP 40 00HQ D0S ? gpꉨ@-A-` p@XR00P0S  }l ~h{00 vh0Sg]l0h= `VhARODl= `B?;1 @-\  $\!0\ x \ p  Ѝ@ P000Ed_{O-M$ 0ZY  $` 1 00 p 0  0 "pP`YX ̐p  0 pPЍ0  0P  0  0 0@P  0 ܩ`٩  0 TfQfO-@DMP`pǩ© h0VSPP P1 h0XPW H P 0 ᴫPP 3`F00h0U"DЍ吩卩 0 R0  X=N QЁ ? T0(0?,0(0p s$0  7q/0 A< 0p<b<! 0  ^    = D1p00 0 0pPP~ ;P   00 0 P0i  $  0|00P \ = @d4w Qb OɠO-,@P`(pct00R4@ 0S  ?T@Ӓt#0R000 T00S @H#0R000 T00S @z#0R000 T00S@n"0R000 T00S@b"0R000 T00S@V"0R000T00S@J"Th"0R00 0S(@>&R00 \)@5"T"0R00 0S2@)!0R00 0S3@ !0R0004@"T@@<@!0R000S=@b%R00@@T@>@ ᝨP  P R0PR0p ` 㬧 0X lЍU@BPkRF64ds64G-p @`P0S  P0SP - SR6! z>h00S04  ^ ࠱\ 000h0R `0X 0`0S` h0P0U ^ ࠱RP00H0[0A-P` x@P p]V@!@1 4 FA1A-Pda `1`@ p00" 001 001 000 0 DkP000幦P000  Ѝ 0000S 0T0 l0 00b 0H!o80 00S0K@6$0G-S0M `P 8% ௦ET0@ST0S S5 400 00 P0S& \i0 0 jP000婤P0@40<$ h%0Ѝ 40 0Hi0000S 0T0 +i!3iL0Sh i, | l \ L0 jP 0 匣 00 UpP` ;P\  N/0  X010 c! `0 -P !hP0S[ 0 p0尀8@ 0CRS&P010! ť[2  000S   # 00@ 5P0hP\0S8! hn0hj4 㰥00SD 40PS;<0  0 @p0l0C 0"1 "P0HpS dipAhRRF64RIFFWAVESg=u_&ؑ^iǐpՏdێEG-T0< @ 0 00e 0`p^ 000 Q BlHT @"_@9! 0@P> 00 004Ѝ@- @(Q,0S (w0(0p0O-Mp0 S p0St" @W  1`"LL" P 0 (.@PE(PJ.J>p  D4 D4H42 0`A- ` p0H-@@ P0@PP R0;i T03   B, 0,Ѝ0 0A-p0!@ P0m`GD1`X 01.0-.Ѝ`!FM,)!FDp@-@ P1 Spp@ O-0 H  0P50 tse`p p00$0Smp0 p@S @*h5 0pI0 0@`Bp 0p:$0*f\ 0@0& ] 0凕 0儕 0 f1  j1 e  00  0 S 0A1  0 @1 SS FS BS DS}S S HSS ʃS SS S S@  ୕00p$  5aa``` 0O-POM `pQ 0 @0@4?0,g0< 8QRT1 DS[ 0P P 0CSdb0@S , S| S S S 50JptSB Sd S40=/S Sd S4033S >Sq 1S40*Sy FSp BSj DS|40}Si Sm HS\40Sl ʃSf S840 S' S" S40400400 # 0,0 030PQ# Oߍ3030303030T0S S, `30X30P30H30@30830030(30 3030303030202020 ̒  " 00@@P3 8P) PP P P ƒt" 0y @R4PY:0PP 00P00R00S3u1P P /P@3P >PP FP BP DP}P P HPP ʃP PP P P  ? 00 ,@d,0PeTC00@dUSPeX X  $(0  $0 XaEaI a``b1a`ma`_aaan_j_9__%____:__;_@_{_______```?`^{`P%` Q/#:P ?o/o C02 P@  !P@ !!P!@ #!!P@ !!P#2!///o b0/P!Q @-@A/Q0  aB Q 00`BS /ooB  S0C !S0C !!S!1C "!S1C !S""!\`B/<`B/3//o b\3`B/PQ @-@A/ 0R b0A1Q A1/ 0R b0AQQ AQ/ 0R bAQ0A/!1#0@-@P40y JZtPe@ 0!"# 0!6U0Ơ! p6#6 r04W @D uΠ2S PE RΠ#SQZ|Q:Q:`l@*rU*\0@D1?o 0 0C S  b 1 b0@T0@@T @@ d010 @d d001046#!@PE 40 010ʰ#0E208Q00 FV100/0@-K2@P0/0@-K2@Q`B a43!/23/0@-MQ /0@-P /0@-QZpK2@!˰\    ! 0bà01@O ! 02BC< ",#buf_ptr < s->buf_endAssertion %s failed at %s:%d ./libavcodec/put_bits.hMPEG-4 AOT %d is not allowed in ADTS Escape sample rate index illegal in ADTS 960/120 MDCT window is not allowed in ADTS Scalable configurations are not allowed in ADTS Extension flag is not allowed in ADTS Only AAC streams can be muxed by the ADTS muxer ADTS frame size too large: %u (max %d) audio/aacaac,adtsADTS muxerwrite_id3v2Enable ID3v2 tag writingwrite_apetagEnable APE tag writingNONENONEraw NONE NONEfl32fl64alawulaw in24 in32 PMAC3 PMAC6PGSM G722G726twossowtima42PQDMCPQDM2PQclpHSDX2ADP4Got more than one picture in stream %d, ignoring. AIFCAIFFAIFF allows only one audio stream and a picture. No audio stream present. block align not set authorcopyrightcommentcould not compute bits per sample audio/aiffaif,aiff,afc,aifcAIFF muxerEnable ID3 tags writing.id3v2_versionSelect ID3v2 version to write. Currently 3 and 4 are supported.#!AMR #!AMR-WB audio/amrInvalid APE tag key '%s'. APE tag size too large. Skipping binary tag '%s'. Error reading cover art. APETAGEXUnsupported tag version. (>=%d) Tag size is way too big Invalid tag size %u. Too many tag fields (%u) APE Tag is a header Non ASCII keys are not allowed crc_tablelibavformat/apngenc.capng->prev_packetOnly a single frame so saving as a normal PNG. Frame rate is too high or specified too precisely. Unable to copy losslessly. APNG muxer supports only a single video APNG stream. Last frame delay is too precise. Reducing to %d/%d (%f). apngimage/pngAPNG muxerplaysNumber of times to play the output: 0 - infinite loop, 1 - no loopfinal_delayForce delay after the last frame*54I@ZFyZ8CkI˥r2CiR[Z"#Un)"&L5~("#UnFC|K)9>A\ LuI͇Q Se#DIANEpTů[wHgDLʝ1(E="e:G@,p qC3I@^Pӫ Se_. Se6&ufblARц1H@Rц1H3&ufblYYHW U[_\D+N[_\D+M[_\D+Pÿa W U[_\D+@iM[_\D+˥r2CiR[Zܷ SeܫG Se0&ufblWM/AlbumArtistWM/AlbumTitleAuthorDescriptionWM/ComposerWM/EncodedByencoded_byWM/EncodingSettingsWM/GenregenreWM/LanguagelanguageWM/OriginalFilenameWM/PartOfSetdiscWM/PublisherpublisherWM/ToolWM/TrackNumberWM/MediaStationCallSignservice_providerWM/MediaStationNameservice_name M4S2 MP4SMP43asf->packet_timestamp_end >= asf->packet_timestamp_startlibavformat/asfenc.cpadsize >= 0packet_hdr_size <= asf->packet_size_leftWindows Media Audio V8ratingcreation_timeAspectRatioXAspectRatioYASF can only handle 127 streams input pts %lld is invalid asf_streamvideo/x-ms-asfasf,wmv,wmaASF stream muxerASF muxerPacket sizeReadOrder gap found between %d and %d Dialogue: wrote %d ASS lines, cached dialogues: %d, waiting for event id %d Marked=Unexpected ReadOrder %d %s%ld,%d:%02d:%02d.%02d,%d:%02d:%02d.%02d,%sMarkedLayerExactly one ASS/SSA stream is needed. [Events]Format: [V4+ Styles][Events] Format: %s, Start, End, Style, Name, MarginL, MarginR, MarginV, Effect, Text text/x-assass,ssaass muxerignore_readorderwrite events immediately, even if they're out-of-ordertotal samples: %lld Loopstart value is out of range and will be ignored Loopend value is out of range and will be ignored only one stream is supported muxing ADPCM AFC is not implemented unsupported codec loopend can't be less or equal to loopstart Invalid loopstart value Invalid loopend value AST muxerloopstartLoopstart position in milliseconds.loopendLoopend position in milliseconds.  2627AlbumTrackauaudio/basic  (!  P!  @!creserve_index_space:%d master_index_max_size:%d RIFFLISTJUNKavist->frames_hdr_strmlibavformat/avienc.cavi->frames_hdr_allOpenDML index duration for audio packets with partial frames?AVI does not support >100 streams hdrlAVI duration_est:%0.3f, filesize_est:%0.1fGiB, master_index_max_size:%d strhSubtitle streams other than DivX XSUBstrf%s rawvideo cannot be written to avi, output file will be unreadable PAL8 with %d bps is not allowed Invalid or not supported codec type '%s' found in the input strnSubtitle - %s-xx;02vprpidx1pb->seekable & (1 << 0)avi->riff_id - avist->indexes.master_odml_riff_id_base < avi->master_index_max_sizemoviAVIXToo large number of skipped frames %lld > 60000 par->bits_per_coded_sample >= 0 && par->bits_per_coded_sample <= 8Output file not strictly OpenDML compliant, consider re-muxing with 'reserve_index_space' option value >= %d avivideo/x-msvideoAVI muxerreserve_index_spacereserve space (in bytes) at the beginning of the file for each stream indexwrite_channel_maskwrite channel mask into wave format headerNULLabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789+-.subfile,https:https protocol not found, recompile FFmpeg with openssl, gnutls or securetransport enabled. tls:!*clibavformat/avio.cImpossible to open the '%s' protocol for reading Impossible to open the '%s' protocol for writing subfileKey '%s' not found. Error parsing options string %s protocol_whitelist!(e=av_dict_get(*options, "protocol_whitelist", ((void *)0), 0)) || (uc->protocol_whitelist && !strcmp(uc->protocol_whitelist, e->value))!(e=av_dict_get(*options, "protocol_blacklist", ((void *)0), 0)) || (uc->protocol_blacklist && !strcmp(uc->protocol_blacklist, e->value))Protocol '%s' not on whitelist '%s'! Protocol '%s' on blacklist '%s'! Setting default whitelist '%s' No default whitelist set !whitelist || !(e=av_dict_get(*options, "protocol_whitelist", ((void *)0), 0)) || !strcmp(whitelist, e->value)!blacklist || !(e=av_dict_get(*options, "protocol_blacklist", ((void *)0), 0)) || !strcmp(blacklist, e->value)failed to rename file %s to %s: %s URLContextList of protocols that are allowed to be usedList of protocols that are not allowed to be usedrw_timeoutTimeout for IO operations (in microseconds)Invalid return value 0 for stream protocol Invalid UTF8 sequence in avio_put_str16%s !s->write_flaglibavformat/aviobuf.cFailed to decrease buffer size Statistics: %d seeks, %d writeouts Statistics: %lld bytes read, %d seeks AVIOContextaarabkaceachadaadyafaafhafrain akaakk albale algaltamhanganpapaaraarcargarmarnarpartarwasmastathausavaaveawa"aymazebad%bai&bakbal(bam ban*baqbas,bat-bej.belbem0ben ber2bho3bihbik5bin6bisbla8bnt9bos bra;bre btk=bua>bug?bulburbynBcadCcaiDcarEcatcauGcebHcelIchachbKchechgMchichkOchmPchnQchoRchpSchrTchuchvchyWcmcXcopYcorQcoscpe\cpf]cpp^crecrh`crpacsbbcuscczedakedandargdayhdelidenjdgrkdinldivdoindraodsbpduaqdumrdutdyutdzoefivegywekaxelxyengenm{epoest eweewofanfao&fatfij%filfin$fiufonfrefrmfrofrrfrsfry(ful#furgaagaygbagemgeogergezgilgla*gle)glg+glv.gmhgohgongorgotgrbgrcgregrn,gswguj-gwihaihat4hau/hawheb0her7hilhimhin1hithmnhmo2hrv3hsbhun5hupibaibo;iceido>iii<ijoikuAile:iloina8incind9ineinhipk=irairoita@javCjbojpnBjprjrbkaakabkackalIkamkanKkarkasNkauMkawkazHkbdkhakhikhmJkhokikFkinkirRkmbkokkomPkonEkorLkoskpekrckrlkrokrukuaGkumkurOkutladlahlamlaoXlatSlav[lezlimVlinWlitYlollozltzTlualubZlugUluilunluolusmacmadmagmah]mai mak mal`man maomapmarbmasmaymdfmdrmenmgamicminmismkhmlg\mltdmncmnimnomohmonamos!mul"mun#mus$mwl%mwr&myn'myv(nah)nai*nap+naufnavonblnndehndojnds1nepinew3nia4nic5niu6nnolnobgnog9non:normnqo<nso=nub>nwc?nyapnymAnynBnyoCnziDociqojiroritormsosaIossuotaKotoLpaaMpagNpalOpamPpanvpapRpauSpeoTperphiVphnWpliwpolxponZporzpra\pro]pusyque{raj`rapararbroacroh|romerumrun}ruphrussadjsagsahlsaimsalnsamosansasqsatrscnsscotselusemvsgawsgnxshnysidzsinsio|sit}sla~sloslvsmasmesmismjsmnsmosmssnasndsnksogsomsonsotspasrdsrnsrpsrrssasswsuksunsussuxswaswesycsyrtahtaitamtatteltemtertettgktglthatibtigtirtivtkltlhtlitmhtogtontpitsitsntsotuktumtupturtuttvltwityvudmugauigukrumbundurduzbvaivenvievolvotwakwalwarwaswelwenwlnwolxalxhoyaoyapyidyorypkzapzblzenzhazndzulzunzxxzzabod cescymdeuelleus!fas"fra'hye6isl?katDmkd_mri^msacmyaenldkron~slksqizhoaaabae!afak amanarasav ay#az$ba'be/bg@bh4bi7bm)bn1bobr<bs:caFceLchJco[cr_csdcuUcvVcydafdedvmdzuee~elenzeo|eset}eu+faUfffifjfofrfygagdglgngugvhahehihohrhthuhyhziaidieigiiikioisitiujajvkakgkikjkkklkmknkokrkskukvkwZkylalblglilnloltlulvmgmhmi mkml mn mrmsmtmyAna,nb8nd/ne2ng0nlsnn7no;nr.nv-ny@ocEojFomHorGosJpaQpiXplYps^pt[qu_rmdrngrofruirwsapscsdsesgksi{skslsmsnsosq srssstsusvswtatetgthtitktltntotrtstttwtyugukuruzvevivowawoxhyiyozazhNzuonly codec g729 with 1 channel is supported by this format audio/bitPaac PaaclPac-3ima4msmsPalac samrPagsmPms1;Pilbc PMAC3 PMAC6*P.mp1P.mp2P.mp3PmsU %s bandwidth="%d" %s %smaster.m3u8Correcting the segment index after file %s: current=%d corrected=%d Representation %d media segment %d written to: %s Segment durations differ too much, enable use_timeline and use_template, or keep a stricter keyframe interval os->parsermpddash muxeradaptation_setsAdaptation sets. Syntax: id=0,streams=0,1,2 id=1,streams=3,4 and so onnumber of segments kept in the manifestextra_window_sizenumber of segments kept outside of the manifest before removing from diskmin_seg_durationminimum segment duration (in microseconds) (will be deprecated)segment duration (in seconds, fractional value can be set)fragment duration (in seconds, fractional value can be set)frag_typeset type of interval for fragmentsone fragment per segmentfragment at every framefragment at specific time intervalsfragment at keyframes and following P-Frame reordering (Video only, experimental)remove_at_exitremove all segments when finisheduse_templateUse SegmentTemplate instead of SegmentListuse_timelineUse SegmentTimeline in SegmentTemplatesingle_fileStore all segments in one file, accessed using byte rangessingle_file_nameDASH-templated name to be used for baseURL. Implies storing all segments in one file, accessed using byte rangesinit_seg_nameDASH-templated name to used for the initialization segmentinit-stream$RepresentationID$.$ext$media_seg_nameDASH-templated name to used for the media segmentschunk-stream$RepresentationID$-$Number%05d$.$ext$utc_timing_urlURL of the page that will return the UTC timestamp in ISO formatset the HTTP methodhttp_user_agentoverride User-Agent field in HTTP headerhttp_persistentUse persistent HTTP connectionshls_playlistGenerate HLS playlist files(master.m3u8, media_%d.m3u8)Enable/Disable streaming mode of output. Each frame will be moof fragmentset timeout for socket I/O operationsindex_correctionEnable/Disable segment index correction logicset list of options for the container format (mp4/webm) used for dashglobal_sidxWrite global SIDX atom. Applicable only for single file, mp4 output, non-streaming modedash_segment_typeset dash segment files typeautoselect segment file format based on codecmake segment file in ISOBMFF formatmake segment file in WebM formatignore_io_errorsIgnore IO errors during open and write. Useful for long-duration runs with network outputlhlsEnable Low-latency HLS(Experimental). Adds #EXT-X-PREFETCH tag with current segment's URIldashEnable Low-latency dash. Constrains the value of a few elementsmaster_m3u8_publish_ratePublish master playlist every after this many segment intervalsWrite producer reference time elementmpd_profileSet profiles. Elements and values used in the manifest may be constrained by themMPEG-DASH ISO Base media file format live profiledvb_dashDVB-DASH profilehttp_optsHTTP protocol optionstarget_latencySet desired target latency for Low-latency dashmin_playback_rateSet desired minimum playback ratemax_playback_rateSet desired maximum playback ratevp8vorbisopusPacket size too large for s302m. (%d > 65535) daud302%08x %02xstream #%d: keyframe=%d duration=%0.3f dts=%0.3f pts= size=%d %1.4f %s%3.2f %s%1.0f %s%1.0fk %s%s - %sMetadata:  %s %-16s: fps, tbr, tbrtbn, tbndump_separator Stream #%d:%d[0x%x](%s), %d, %d/%d: %s, SAR %d:%d DAR %d:%dtbc (dub) (original) (comment) (lyrics) (karaoke) (forced) (hearing impaired) (visual impaired) (clean effects) (attached pic) (timed thumbnails) (captions) (descriptions) (metadata) (dependent) (still image) %sSide data: %s palettenew extradataparamchange: channel count %u, channel layout: %s, sample_rate %u, width %u height %uunknown paramH.263 macroblock inforeplaygain: invalid datatrack gaintrack peakalbum gainalbum peakdisplaymatrix: rotation of %.2f degreesstereo3d: (inverted)audio service type: effectsvisually impairedhearing impaireddialoguecommentaryemergencyvoice overkaraokequality factor: %d, pict_type: %ccpb: bitrate max/min/avg: %d/%d/%d buffer size: %d vbv_delay: N/Avbv_delay: %lluMastering Display Metadata, has_primaries:%d has_luminance:%d r(%5.4f,%5.4f) g(%5.4f,%5.4f) b(%5.4f %5.4f) wp(%5.4f, %5.4f) min_luminance=%f, max_luminance=%fspherical: %s (%f/%f/%f) [%zu, %zu, %zu, %zu] [pad %u] Content Light Level Metadata, MaxCLL=%d, MaxFALL=%dICC ProfileDOVI configuration record: version: %d.%d, profile: %d, level: %d, rpu flag: %d, el flag: %d, bl flag: %d, compatibility id: %dunknown side data type %d (%d bytes)OutputInputfrom%s #%d, %s, %s '%s': Duration: %02lld:%02lld:%02lld.%02lld, start: %s%d.%06d, bitrate: %lld kb/s Chapter #%d:%d: start %f, end %f Program %d %s No Program PQRSPQRSPQRSPQRSPQRSPQRSPQRSPQRSPQRSPQRSPQRSPQRSCan't initialize DV format! Make sure that you supply exactly two streams: video: 25fps or 29.97fps, audio: 2ch/48|44|32kHz/PCM (50Mbps allows an optional second audio stream) sample_rate == 48000libavformat/dvenc.cCan't process DV frame #%d. Insufficient audio data or severe sync problem. Unexpected frame size, %d != %d Can't process DV frame #%d. Insufficient video data or severe sync problem. dv;FFMETADATA[STREAM][CHAPTER]TIMEBASE=%d/%d START=%lld END=%lld ffmetadataffmetarecovery_wait_streamtime can be turned on only when drop_pkts_on_overflow is also turned on pthread join error: %s FIFO queue full Failed to start thread: %s Error opening %s: %s Unknown option '%s' ret >= 0libavformat/fifo.cKeyframe received, recovering... Dropping non-keyframe packet Recovery attempt #%d/%d Recovery attempt #%d Recovery failed: %s Packet does not contain presentation timestamp, recovery will be attempted immediatelyMaximal number of %d recovery attempts reached. Recovery successful FIFO queue flushed Fifo muxerfifo_formatTarget muxerSize of fifo queueformat_optsOptions to be passed to underlying muxerdrop_pkts_on_overflowDrop packets on fifo queue overflow not to block encoderrestart_with_keyframeWait for keyframe when restarting outputattempt_recoveryAttempt recovery in case of failuremax_recovery_attemptsMaximal number of recovery attemptsrecovery_wait_timeWaiting time between recovery attemptsrecovery_wait_streamtimeUse stream time instead of real time while waiting for recoveryrecover_any_errorAttempt recovery regardless of type of the error,%dflush count: %d pts seen nr: %d pts seen: fifo_testFifo test muxerwrite_header_retwrite_header() return valuewrite_trailer_retwrite_trailer() return valueprint_deinit_summaryprint summary when deinitializing muxer..file:file,crypto,datatruncatetruncate existing files on writeblocksizeset I/O operation maximum block sizefollowFollow a file as it is being writtenSets if the file is seekableonly AV_PIX_FMT_RGBA is supported filmstripflmSIMPLE = XTENSION= 'IMAGE 'BITPIXNAXISNAXIS1NAXIS2NAXIS3PCOUNTGCOUNTBZEROCTYPE3 = 'RGB 'ENDfitsInvalid audio stream. Exactly one FLAC audio stream is required. Video stream #%d is not an attached picture. Ignoring GIF image support is not implemented. Can't write attached pictures without a header. Only audio streams and pictures are allowed in FLAC. WAVEFORMATEXTENSIBLE_CHANNEL_MASKA WAVEFORMATEXTENSIBLE_CHANNEL_MASK is already present, this muxer will not overwrite it. 0x%llxLavf58.45.100No mimetype is known for stream %d, cannot write an attached picture. Duplicate attachment for type '%s' File icon attachment must be a 32x32 PNGPicture block too big %d >= %d No packets were sent for some of the attached pictures. unable to rewrite FLAC header. Out of memory in packet queue; skipping attached pictures Out of memory queueing an attached picture; skipping audio/x-flacflac muxerwrite_headerWrite the file headerfLaC" V\[jwXD}]"V>.+@P P !P#P aac_adtstoascFLV only supports wideband (16kHz) Speex audio FLV only supports mono Speex audio FLV does not support sample rate %d, choose from (44100, 22050, 11025) Audio codec '%s' not compatible with FLV %s codec %s not compatible with flv at most one video stream is supported in flv Codec %s is not supported in the official FLV specification, use vstrict=-1 / -strict -1 to use it anyway. Muxing VP6 in flv will produce flipped video on playback. at most one audio stream is supported in flv 16-bit big-endian audio in flv is valid but most likely unplayable (hardware dependent); use s16le Subtitle codec '%s' for stream %d is not compatible with FLV Codec type '%s' for stream %d is not compatible with FLV onMetaDataheightvideodatarateframeratevideocodecidaudiodatarateaudiosamplerateaudiosamplesizestereoaudiocodeciddatastreamdatasizelasttimestamptotalframeshasAudiohasVideohasCuePointshasMetadatahasKeyframesIgnoring metadata for %s canSeekToEndvideosizeaudiosizelastkeyframetimestamplastkeyframelocationAAC sequence header: %02x %02x. Empty audio Packet Packets are not in the proper order with respect to DTS Packet is missing PTS libavformat/flvenc.cMalformed AAC bitstream detected: use the audio bitstream filter 'aac_adtstoasc' to fix it ('-bsf:a aac_adtstoasc' option with ffmpeg) aac bitstream error Warning: Speex stream has more than 8 frames per packet. Adobe Flash Player cannot handle this! Too large packet with size %u >= %u onTextDataTextno mem for add keyframe index! par->codec_type is type = [%d] Unable to re-open %s output file for the second pass (add_keyframe_index) filepositionsFLV no sequence end mode open Failed to update header with correct duration. Failed to update header with correct filesize. video/x-flvflv muxerflvflagsFLV muxer flagsaac_seq_header_detectPut AAC sequence header based on stream datano_sequence_enddisable sequence end for FLVno_metadatadisable metadata for FLVno_duration_filesizedisable duration and filesize zero value metadata for FLVadd_keyframe_indexAdd keyframe index metadataimage2image2pipeProbing %s score:%d size:%d Probing %s score:%d increased to %d due to MIME type Specified probe size value %u cannot be < %u mime_typeFormat %s detected only with low score of %d, misdetection possible! Format %s probed with size=%d and score=%d %d, %10lld, %10lld, %8lld, %8d, 0x%08x, F=0x%0X, S=%d#extradata %d: %8d, 0x%08x #software: %s #tb %d: %d/%d #media_type %d: %s #codec_id %d: %s #sample_rate %d: %d #channel_layout %d: %llx #channel_layout_name %d: %s #dimensions %d: %dx%d #sar %d: %d/%d buf_size >= 0./libavcodec/bytestream.hGIF muxer supports only a single video GIF stream. NETSCAPE2.0image/gifGIF muxerNumber of times to loop the output: -1 - no loop, 0 - infinite loopForce delay (in centiseconds) after the last frame                                 P@`8Ver 1 Br %.6f Ipg 1 Ppi %d Bpiop %d Pix 0 Cf %d Cg %d Sl %d nl16 %d Vi 1 f1 1 size < sizeof(buffer)libavformat/gxfenc.cEXT:/PDR/default/ES.could not realloc map offsets EXT:/PDR/default/gxf muxer does not support streamed output, patch welcome only 16 BIT PCM LE allowed for now only 48000hz sampling rate is allowed only mono tracks are allowed n=32768pcm_rechunkvideo stream must be the first track unsupported video resolution, gxf muxer only accepts PAL or NTSC resolutions currently video codec not supported %d:%d:%d%c%dunable to parse timecode, syntax: hh:mm:ss[:;.]ff could not reallocate flt entries gxfvadst%d,%c,%s=%d, %10lld, %10lld, %8lld, %8d, #format: frame checksums #version: %d #hash: %s #extradata %d, %31d, #stream#, dts, pts, duration, size, hash framemd5frame MD5 muxerframehashframe hash muxerstreamhashstream hash muxerset hash to useformat_versionfile format versionsha256%s/stream%d.abst%s/stream%d.abst.tmpUnable to open %s for writing recorded%s/index.f4m%s/index.f4m.tmp %s %s streaming %f %s %s/stream%dSeg1-Frag%dFailed to create directory %s Unsupported stream type in stream %d %s/stream%d_tempNo video stream in output stream %d and no min frag duration set hdsHDS muxernumber of fragments kept in the manifestnumber of fragments kept outside of the manifest before removing from diskmin_frag_durationminimum fragment duration (in microseconds)remove all fragments when finishedconfigurationVersion: %u general_profile_space: %u general_tier_flag: %u general_profile_idc: %u general_profile_compatibility_flags: 0x%08x general_constraint_indicator_flags: 0x%012llx general_level_idc: %u min_spatial_segmentation_idc: %u parallelismType: %u chromaFormat: %u bitDepthLumaMinus8: %u bitDepthChromaMinus8: %u avgFrameRate: %u constantFrameRate: %u numTemporalLayers: %u temporalIdNested: %u lengthSizeMinusOne: %u numOfArrays: %u array_completeness[%u]: %u NAL_unit_type[%u]: %u numNalus[%u]: %u nalUnitLength[%u][%u]: %u %vMore than 1 variant streams are present, %%v is expected either in the filename or in the sub-directory name of file %s %%v is expected either in the filename or in the sub-directory name of file %s, but only in one of them %0*lldlibavformat/hlsenc.chttpfailed to delete old segment %s: %s Unable to find relative url PUT#EXT-X-DISCONTINUITY #EXT-X-INDEPENDENT-SEGMENTS #EXT-X-KEY:METHOD=AES-128,URI="%s",IV=0x%sFailed to open master play list file '%s' #EXT-X-MEDIA:TYPE=CLOSED-CAPTIONS,NAME="%s",LANGUAGE="%s",INSTREAM-ID="%s" Unable to find relative URL Media stream not found mapping ccgroup %s not found Unable to find relative subtitle URL Master playlist creation failed Invalid segment filename template '%s', you can try to use -strftime 1 with it Could not get segment filename with strftime Invalid second level segment filename template '%s', you can try to remove second_level_segment_index flag Invalid second level segment filename template '%s', you can try to remove second_level_segment_size flag Invalid second level segment filename template '%s', you can try to remove second_level_segment_time flag Could not create directory %s with use_localtime_mkdir Invalid segment filename template '%s' you can try to use -strftime 1 with it Invalid segment filename template '%s' Encrypted fmp4 not yet supported Cannot use both -hls_key_info_file and -hls_enc, ignoring -hls_enc error opening key info file %s no key URI specified in key info file no key file specified in key info file error opening key file %s error reading key file %s .keyCannot generate a strong random key %032llxmpegts_flagsavc1.%02x%02x%02xmp4a.40.33mp4a.40.34mp4a.40.2ac-3ec-3Your video bitrate is bigger than hls_segment_size, (%lld > %lld), the result maybe not be what you want.deleting old segment %s %s%cDuplicated segment filename detected: %s #EXTM3U#EXT-X-MEDIA-SEQUENCE:Found playlist sequence number was smaller than specified start sequence number: %lld < %lld, omitting Found playlist sequence number: %lld #EXT-X-DISCONTINUITY#EXTINF:#EXT-X-KEY:URI="IV=0x%d.vtt-%Y%m%d%H%M%S.m4s-%s.ts-%s.m4s-%Y%m%d%H%M%S.ts%d.m4s%d.ts ccgroup:instreamid:language:Invalid keyval %s Insufficient parameters in cc stream map string Invalid instream ID CC index %d in %s, range 1-4 SERVICEInvalid instream ID SERVICE index %d in %s, range 1-63 Invalid instream ID %s, supported are CCn or SERVICEn a:v:default:YESname:agroup:sgroup:Invalid stream number: '%s' Same elementary stream found more than once inside variant definition #%d Same elementary stream found more than once in two different variant definitions #%d and #%d Unable to map stream at %s Number of variant streams %d Variant stream info update failed with status %x No HTTP method set, hls muxer defaulting to method PUT. init.mp4Master stream info update failed with status %x %Y%m%d%H%M%Sstart_number evaluated to %lld 'split_by_time' and 'independent_segments' cannot be enabled together. Disabling 'independent_segments' flag More than a single video stream present, expect issues decoding it. _%dsecond_level_segment_duration hls_flag works only with file protocol segment names second_level_segment_size hls_flag works only with file protocol segment names second_level_segment_duration hls_flag requires strftime to be true second_level_segment_size hls_flag requires strfime to be true second_level_segment_index hls_flag requires strftime to be true webvtt%s_vtt.m3u8http persistent mode is currently unsupported for fragment mp4 in the HLS muxer. Multi-file byterange mode is currently unsupported in the HLS muxer. Failed to open segment '%s' -autobsffflags+frag_custom+dash+delay_moovsdt_periodpat_periodSome of the provided format options are not recognized append_list mode does not support hls_init_time, hls_init_time value will have no effect encryption_keyencryption_ivcrypto:%sFailed to open file '%s' upload segment failed, will retry with a new http session. Failed to upload file '%s' at the end. upload playlist failed, will retry with a new http session. pkt->duration = 0, maybe the hls segment duration will not precise Unable to find mapping variant stream hls muxerset first number in the sequenceset segment length in secondshls_init_timeset segment length in seconds at init listhls_list_sizeset maximum number of playlist entrieshls_delete_thresholdset number of unreferenced segments to keep before deletinghls_ts_optionsset hls mpegts list of options for the container format used for hlshls_vtt_optionsset hls vtt list of options for the container format used for hlshls_wrapset number after which the index wraps (will be deprecated)hls_allow_cacheexplicitly set whether the client MAY (1) or MUST NOT (0) cache media segmentshls_base_urlurl to prepend to each playlist entryhls_segment_filenamefilename template for segment fileshls_segment_sizemaximum size per segment file, (in bytes)hls_key_info_filefile with key URI and key file pathhls_encenable AES128 encryption supporthls_enc_keyhex-coded 16 byte key to encrypt the segmentshls_enc_key_urlurl to access the key to decrypt the segmentshls_enc_ivhex-coded 16 byte initialization vectorhls_subtitle_pathset path of hls subtitleshls_segment_typeset hls segment files typemake segment file to mpegts files in m3u8fmp4make segment file to fragment mp4 files in m3u8hls_fmp4_init_filenameset fragment mp4 file init filenamehls_fmp4_init_resendresend fragment mp4 init file after refresh m3u8 every timehls_flagsset flags affecting HLS playlist and media file generationgenerate a single media file indexed with byte rangestemp_filewrite segment and playlist to temporary file and rename when completedelete_segmentsdelete segment files that are no longer part of the playlistround_durationsround durations in m3u8 to whole numbersdiscont_startstart the playlist with a discontinuity tagomit_endlistDo not append an endlist when ending streamsplit_by_timesplit the hls segment by time which user set by hls_timeappend_listappend the new segments into old hls segment listprogram_date_timeadd EXT-X-PROGRAM-DATE-TIMEsecond_level_segment_indexinclude segment index in segment filenames when use_localtimesecond_level_segment_durationinclude segment duration in segment filenames when use_localtimesecond_level_segment_sizeinclude segment size in segment filenames when use_localtimeperiodic_rekeyreload keyinfo file periodically for re-keyingindependent_segmentsadd EXT-X-INDEPENDENT-SEGMENTS, whenever applicableiframes_onlyadd EXT-X-I-FRAMES-ONLY, whenever applicableset filename expansion with strftime at segment creation(will be deprecated)strftimeset filename expansion with strftime at segment creationuse_localtime_mkdircreate last directory component in strftime-generated filename(will be deprecated)strftime_mkdircreate last directory component in strftime-generated filenamehls_playlist_typeset the HLS playlist typepl_typeeventEVENT playlistvodVOD playlistset the HTTP method(default: PUT)hls_start_number_sourceset source of first number in sequencestart_sequence_source_typegenericstart_number value (default)epoch_usmicroseconds since epochdatetimecurrent datetime as YYYYMMDDhhmmssvar_stream_mapVariant stream map stringcc_stream_mapClosed captions stream map stringmaster_pl_nameCreate HLS master playlist with this namemaster_pl_publish_ratePublish master play list every after this many segment intervalsIgnore IO errors for stable long-duration runs with network outputset custom HTTP headers, can override built in default headers#EXTM3U #EXT-X-VERSION:%d NO#EXT-X-MEDIA:TYPE=AUDIO,GROUP-ID="group_%s",NAME="audio_%d",DEFAULT=%s,LANGUAGE="%s",URI="%s" #EXT-X-MEDIA:TYPE=SUBTITLES,GROUP-ID="%s",NAME="subtitle_%d",DEFAULT=%s,Bandwidth info not available, set audio and video bitrates #EXT-X-STREAM-INF:BANDWIDTH=%d,RESOLUTION=%dx%d,CODECS="%s",AUDIO="group_%s",CLOSED-CAPTIONS="%s",SUBTITLES="%s" %s #EXT-X-ALLOW-CACHE:%s #EXT-X-TARGETDURATION:%d #EXT-X-MEDIA-SEQUENCE:%lld #EXT-X-PLAYLIST-TYPE:EVENT #EXT-X-PLAYLIST-TYPE:VOD #EXT-X-I-FRAMES-ONLY #EXT-X-MAP:URI="%s",BYTERANGE="%lld@%lld"#EXTINF:%ld, #EXTINF:%f, #EXT-X-BYTERANGE:%lld@%lld strftime error in ff_hls_write_file_entry %z%c%02d%02d#EXT-X-PROGRAM-DATE-TIME:%s.%03d%s #EXT-X-ENDLIST URL read error: %s 0 %x application/octet-streamForbiddenBad RequestOKtext/plainNot FoundInternal server errorHTTP/1.1 %03d %s Content-Type: %s Content-Length: %zu %s %03d %s HTTP/1.1 %03d %s Content-Type: %s Transfer-Encoding: chunked %s HTTP reply header: %s---- %d%b%Y%H%M%SChunked encoding data size: %llu Last chunk received, closing conn Invalid chunk size %llu Stream ends prematurely at %llu, should be %llu s->chunksize >= lenlibavformat/http.cexpiressc->listenGETheader='%s' Received method: %s Received and expected HTTP method do not match. (%s expected, %s received) Autodetected %s HTTP method Received and autodetected HTTP method did not match (%s autodetected %s received) Requested resource: %s HTTP/Malformed HTTP version string. HTTP version string: %s HTTP/1.0http_code=%d HTTP error %d %s Content-LengthContent-Rangebytes Accept-RangesTransfer-EncodingchunkedWWW-AuthenticateAuthentication-InfoProxy-AuthenticateConnectioncloseServerAkamaiGHostMediaGatewayContent-TypeSet-CookieUnable to parse '%s' Icy-MetaIntIcy-Content-EncodinggzipCompressed (%s) content, need zlib with gzip support deflateidentityUnknown content coding: %s tlskeep-alivehttp_proxyno_proxyhttp://https/%sLavf/58.45.100%%%02X HTTP/1.1 Transfer-Encoding: chunked User-Agent: User-Agent: %s Referer: Referer: %s Accept: Accept: */* Range: Range: bytes=%llu- Expect: Expect: 100-continue Connection: Connection: %s Host: Host: %s Content-Length: Content-Length: %d Content-Type: Content-Type: %s Cookie: domain%s; %s=%sCookie: %s Icy-MetaData: Icy-MetaData: 1 Proxy-%srequest: %s overlong headers Lower protocol Read headers Reply code: %d readingCannot reuse HTTP connection for different host: %s:%d != %s:%d Opening '%s' for %s Will reconnect at %llu in %d second(s), error=%s. Failed to reconnect at %llu. ='';Metadata update for %s: %s icy_metadata_packetNo trailing CRLF found in HTTP header. Adding it. http,https,tls,rtp,tcp,udp,crypto,httpproxy,datacontrol seekability of connectionchunked_postuse chunked transfer-encoding for postsset HTTP proxy to tunnel throughcontent_typeset a specific content type for the POST messagesoverride User-Agent headerrefereroverride referer headeruser-agentuse the "user_agent" option insteaduse persistent connectionspost_dataset custom HTTP post dataexport the MIME typehttp_versionexport the http response versioncookiesset cookies to be sent in applicable future requests, use newline delimited Set-Cookie HTTP field value syntaxicyrequest ICY metadataicy_metadata_headersreturn ICY metadata headersreturn current ICY metadata packetmetadata read from the bitstreamauth_typeHTTP authentication typeNo auth method set, autodetectHTTP basic authenticationsend_expect_100Force sending an Expect: 100-continue header for POSTThe actual location of the data receivedinitial byte offsetend_offsettry to limit the request to bytes preceding this offsetOverride the HTTP method or set the expected HTTP method from a clientreconnectauto reconnect after disconnect before EOFreconnect_at_eofauto reconnect at EOFreconnect_streamedauto reconnect streamed / non seekable streamsreconnect_delay_maxmax reconnect delay in seconds after which to give uplisten on HTTPresourceThe resource requested by a clientreply_codeThe http status code to return to a clientnextnonce=realm=opaque=algorithm=qop=stale=authtrueAuthorization: Basic MD5MD5-sessauth-intAuthorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", algorithm="%s", opaque="%s", qop="%s", cnonce="%s", nc=%sICO already contains %d images Invalid BMP Output is not seekable BMP must be 1bit, 4bit, 8bit, 16bit, 24bit, or 32bit PNG in ico requires pixel format to be rgba Unsupported codec %s Unsupported dimensions %dx%d (dimensions cannot exceed 256x256) icoimage/vnd.microsoft.iconBluesClassic RockCountryDanceDiscoGrungeHip-HopNew AgeOldiesOtherR&BReggaeAlternativeSkaDeath MetalPranksSoundtrackEuro-TechnoAmbientTrip-HopVocalJazz+FunkTranceClassicalInstrumentalAcidGameSound ClipGospelNoiseAlternRockSpaceMeditativeInstrumental PopInstrumental RockEthnicGothicDarkwaveTechno-IndustrialElectronicPop-FolkEurodanceDreamSouthern RockComedyCultGangstaTop 40Christian RapPop/FunkJungleNative AmericanCabaretNew WavePsychedelicRaveShowtunesTrailerLo-FiTribalAcid PunkAcid JazzPolkaRetroMusicalRock & RollHard RockFolk-RockNational FolkSwingFast FusionBebopLatinRevivalCelticBluegrassAvantgardeGothic RockProgressive RockPsychedelic RockSymphonic RockSlow RockBig BandChorusEasy ListeningAcousticHumourSpeechChansonOperaChamber MusicSonataSymphonyBooty BassPrimusPorn GrooveSatireSlow JamClubTangoSambaFolklorePower BalladRhythmic SoulFreestyleDuetPunk RockDrum SoloA CappellaEuro-HouseDance HallGoaDrum & BassClub-HouseHardcore TechnoTerrorIndieBritPopNegerpunkPolsk PunkChristian Gangsta RapHeavy MetalBlack MetalCrossoverContemporary ChristianChristian RockMerengueSalsaThrash MetalAnimeJpopSynthpopAbstractArt RockBaroqueBhangraBig BeatBreakbeatChilloutDowntempoDubEBMEclecticElectroElectroclashEmoExperimentalGarageGlobalIDMIllbientIndustro-GothJam BandKrautrockLeftfieldLoungeMath RockNew RomanticNu-BreakzPost-PunkPost-RockPsytranceShoegazeSpace RockTrop RockWorld MusicNeoclassicalAudiobookAudio TheatreNeue Deutsche WellePodcastIndie RockG-FunkDubstepGarage RockPsybientimage/gifaimage/jpegimage/jpgimage/png=image/tiff`image/bmpNJPGPNG=TDATTIMETORYTRDATSIZTYERTDENTDORTDRCTDRLTDTGTIPLTMCLTMOOTPROTSOATSOPTSOTTSSTTALBTBPMTCOMTCONTCOPTDLYTENCTEXTTFLTTIT1TIT2TIT3TKEYTLANTLENTMEDTOALTOFNTOLYTOPETOWNTPE1TPE2TPE3TPE4TPOSTPUBTRCKTRSNTRSOTSRCTSSEError opening memory stream Cannot read BOM value, input too short Incorrect BOM value Unknown encoding PRIVFailed to alloc %zu bytes Failed to alloc %d bytes Error reading GEOB frame, data truncated. GEOBError reading frame %s, skipped Unknown attached picture mimetype: %s, skipping. Unknown attached picture type %d. Error decoding attached picture description. APICTCONTCO(%d)TXXXTXXCHAPCOMMencryptedencrypted and compressedextended header too long.invalid extended header lengthcompressionid3v2 ver:%d flags:%02X len:%d Invalid empty frame %s, skipping. Skipping %s ID3v2 frame %s. USLTFailed to read tag data lyrics-%s%s%sError reading comment frame, skipped invalid frame id, assuming padding TYERTYETDATTDA-%.2s-%.2sTIM %.2s:%.2sError reading lyrics, skipped ID3v2.%d tag skipped, cannot handle %s id3v2_priv.%s\x%02xGEO32x32 pixels 'file icon'Other file iconCover (front)Cover (back)Leaflet pageMedia (e.g. label side of CD)Lead artist/lead performer/soloistArtist/performerConductorBand/OrchestraLyricist/text writerRecording LocationDuring recordingDuring performanceMovie/video screen captureA bright coloured fishIllustrationBand/artist logotypePublisher/Studio logotypeTALTCPcompilationTT2TENTP1TP2TP3TCMPTDRCTDRLTDENTSOAalbum-sortTSOPartist-sortTSOTtitle-sortTALBTCOMTCOPTENCTIT2TLANTPE1TPE2TPE3TPOSTPUBTRCKTSSElyrics%.2s%.2sid3v2_priv.\xInvalid escape '\x%.2s' in metadata tag 'id3v2_priv.%s'. ch%dFrame rate must be integer Frame rate may not exceed 255fps For vintage compatibility fps must be 30 roq#!iLBC20 #!iLBC30 Unrecognized iLBC file header Unsupported number of streams Unsupported codec Unsupported mode ilbcaudio/iLBCjpsljpgjlspnsmngppmpnmpgmpgmyuvpbmpampfmpixddsmpg1-imgmpg2-imgmpg4-imgbmptgatifftifdngsgipcxpicpctpictsunim1im8im24im32sunrassvgsvgzj2cjp2jpcj2kdpxexryuv10webpxbmxpmxfacexwdCould not get frame filename with strftime Cannot write filename by pts of the frames.Could not get frame filename number %d from pattern '%s'. Use '-frames:v 1' for a single image, or '-update' option, or use a pattern such as %%03d within the filename. Could not open file : %s Could not recognize some protocol options UVAxbmp,dpx,jls,jpeg,jpg,ljpg,pam,pbm,pcx,pgm,pgmyuv,png,ppm,sgi,tga,tif,tiff,jp2,j2c,j2k,xwd,sun,ras,rs,im1,im8,im24,sunras,xbm,xface,pix,yimage2 muxerupdatecontinuously overwrite one fileuse strftime for filenameframe_ptsuse current frame pts for filenameatomic_writingwrite files atomically (using temporary files and renames)protocol_optsspecify protocol options for the opened filesgetaddrinfo(%s, %s): %s Simultaneously including and excluding sources is not supported.    sf,ircamengfrageritadutsvespadanpornorhebjpnarafingreicemltturhr chiurdhinthakorlitpolhunestlavfo ruschiirialbroncesslkslvyidsr macbulukrbeluzbkazazeazearmgeomolkirtgktukmonpuskurkassndtibnepsanmarbenasmgujpa orimalkantamtelburkhmlaovieindtglmaymayamhtirormsomswarunmlgepowelbaqcatlatquegrnaymtatuigdzojavPP P!P"-P$def33lqs7uu?yy?~?`  ; gpmdptextptx3gxc608Pmp4aPac-3Psac3ima4Palac samr sawbPdtscPdtshPdtslPdtsePDTS (Pec-3PvdvaPdvcaPagsm;Pilbc PMAC3 PMAC6*P.mp1P.mp2P.mp3Pmp3 PUsm!Pnmos!PNELLalawfl32fl32fl64fl64ulawtwossowtlpcmlpcm in24 in24 in32in32sowtraw NONEPQclpPQclqPsqcpPQDM22PQDMC#Pspex#PSPXNXsevcXssmv PfLaC,Pmlpa= needed_bytessize >= 2LavfExtradata corrupt. Invalid extradata found, ALAC expects a 36-byte QuickTime atom.codec %s is not supported by this format No bmp codec tag found for codec %s No wav codec tag found for codec %s bytes <= 8Writing block of size %d with pts %lld, dts %lld, duration %lld at relative offset %lld in cluster at offset %lld. TrackNumber %u, keyframe %d Error when reformatting data of a packet from stream %d. Invalid chapter start (%lld) or end (%lld). D_WEBVTT/SUBTITLESD_WEBVTT/METADATAD_WEBVTT/DESCRIPTIONSD_WEBVTT/CAPTIONSRaw RGB is not supported Natively in Matroska, you can use AVI or NUT or If you would like to store it anyway using VFW mode, enable allow_raw_vfw (-allow_raw_vfw 1) The specified stereo mode is not valid. alpha_modeOverflow in display width Unknown projection type Initial padding is invalid A_MS/ACMSubtitle codec %d is not supported. Only audio, video, and subtitles are supported for Matroska. Only VP8 or VP9 or AV1 video and Vorbis or Opus audio and WebVTT subtitles are supported for WebM. V_QUICKTIMEV_MS/VFW/FOURCCDURATIONget_metadata_duration found duration in context metadata: %lld get_metadata_duration returned: %lld Write early duration from recording time = %llu Write early duration from metadata = %llu Attachment stream %d has no filename tag. Can't write packet with unknown timestamp Starting new cluster due to timestamp Starting new cluster with timestamp %lld at offset %lld bytes %.*s %.*s %.*sCould not write cached audio packet ret:%d idx >= 0 && idx < num_tracksInsufficient space reserved for Cues: %d < %llu. No Cues will be output. stream %d end duration = %llu %02d:%02d:%012.9fFlushing cluster at offset %llu bytes Invalid FLAC STREAMINFO metadata for output stream %d Ignoring new extradata in a packet for stream %d. audio/x-matroskamkamatroska audio muxervideo/webmwebm muxervideo/x-matroskamkvmatroska muxerReserve a given amount of space (in bytes) at the beginning of the file for the index (cues).Store at most the provided amount of bytes in a cluster. Store at most the provided number of milliseconds in a cluster.Create a WebM file conforming to WebM DASH specificationTrack number for the DASH streamWrite files assuming it is a live stream.allow_raw_vfwallow RAW VFW modewrite_crc32write a CRC32 element inside every Level 1 elementdefault_modeControls how a track's FlagDefault is inferredinferFor each track type, mark the first track of disposition default as default; if none exists, mark the first track as default.infer_no_subsFor each track type, mark the first track of disposition default as default; for audio and video: if none exists, mark the first track as default.passthroughUse the disposition flag as-is{%lld}Exactly one MicroDVD stream is needed. {DEFAULT}{}text/x-microdvdMore than one stream unsupported # timecode format v2 mkvtimestamp_v2ATRVN:Lavf,VN:Lavf58.45.100,Unsupported sample rate %d, supported are 4000, 8000, 11025, 22050 and 44100 Yamaha SMAF stereo is experimental, add '-strict %d' if you want to use it. CNTIOPDAAwammfapplication/vnd.smafP0  0ݺ/ fz˗Bq㯬̂cUJXzR " "!`""d"e""""+""H""& RS      %xD 9 : !   0 1this file requires zlib support compiled in Found media data tag MPEG indicating this is a MOV-packed MPEG-PS. Unknown MOV field order 0x%04x enda %d Empty AV1 Codec Configuration Box Atoms too deeply nested Detected moov in a free or hoov atom. Broken file, trak/mdat not at top-level type:'%s' parent:'%s' sz: %lld %lld %lld overread end of atom '%.4s' by %lld bytes ignoring multiple glbl Found duplicated MOOV Atom. Skipped it root atom offset 0x%llx: partial file read fragments, offset 0x%llx STREAMINFO must be first FLACMetadataBlock non-STREAMINFO FLACMetadataBlock(s) ignored frag flags 0x%x could not find corresponding trex (id %u) could not find corresponding track id %u track[%u].sdtp.entries = %lld Duplicated SDTP atom ctype=%s stype=%s handler_nameiTunSMPB%*X %X %X %XcdecUnhandled or malformed custom metadata of size %lld qt ISO: File Type Major Brand: %.4s major_brandminor_versioncompatible_brandsDOVI in dvcC/dvvC box, version: %d.%d, profile: %d, level: %d, rpu flag: %d, el flag: %d, bl flag: %d, compatibility id: %d Empty Content Light Level Info box Empty Content Light Level box Unsupported Content Light Level box version %d Invalid Mastering Display Color Volume box Empty Mastering Display Metadata box Unsupported Mastering Display Metadata box version %d Empty VP Codec Configuration box Unsupported VP Codec Configuration box version %d unsupported OpusSpecificBox version Empty spherical video box Missing spherical video header Unknown spherical version %d Missing projection box Missing projection header box Unsupported cubemap layout %d Invalid bounding rectangle coordinates %u,%u,%u,%u Unknown projection type: %s Empty stereoscopic video box Unknown st3d mode value %d tenc atom are only supported in first sample descriptor invalid per-sample IV size value failed to read the default key ID invalid default_constant_IV_size in tenc atom failed to read the default IV schm boxes are only supported in first sample descriptor track[%u].stts.entries = %u Duplicated STTS atom sample_count=%d, sample_duration=%d reached eof, corrupted STTS atom Failed to read the system id Failed to read the key id Hit EOF while reading pssh systemBitrate="equirectangularleft-righttop-bottomInvalid spherical metadata found Duplicated SBGP atom reached eof, corrupted SBGP atom keyframe_count = %u Duplicated STSS atom reached eof, corrupted STSS atom track[%u].stsc.entries = %u Duplicated STSC atom STSC entry %d is invalid (first=%d count=%d id=%d) sc->stsc_data[i+1].first >= 2libavformat/mov.creached eof, corrupted STSC atom Duplicated STPS atom reached eof, corrupted STPS atom Invalid edit list entry_count: %d for elst atom of size: %lld bytes. ELST atom of %lld bytes, bigger than %d entries.Duplicated ELST atom track[%u].edit_count = %i duration=%lld time=%lld rate=%f Track %d, edit %d: Invalid edit list media time=%lld STCO outside TRAK Duplicated STCO atom reached eof, corrupted STCO atom get_wav_header failed nclxnclcprofunsupported color_parameter_type %s %s: pri %d trc %d matrix %d full %uvolume %s, len %d filename %s, len %d nlvl from %d, nlvl to %d type %d, len %d path %s dir %s Unknown dref type 0x%08x size %u sample aspect ratio already set to %d:%d, ignoring 'pasp' atom (%d:%d) stream %d, sample %d, dts %lld ctts_indexctts_sample../Using absolute path on user request, this is a possible security issue Absolute path %s not tried for security reasons, set demuxer option use_absolute_path to allow absolute paths Reference with mismatching origin, %s not tried for security reasons, set demuxer option use_absolute_path to allow it anyway %grotatesidx version %uInvalid sidx timescale 1/%d sidx reference_type 1could not find corresponding track id %d stream has moof boxes, will look for a mfra doesn't look like mfra (unreasonable size) doesn't look like mfra (size mismatch) doesn't look like mfra (tag mismatch) stream has mfra found tfra failed to seek back after looking for mfra found a moof box but failed to read the mfra (may be a live ismv) found a moof box but stream is not seekable, can not look for mfra moof offset %llx [aax] file checksum == [aax] activation_bytes option is missing! [aax] activation_bytes value needs to be 4 bytes! [aax] audible_fixed_key value needs to be 16 bytes! [aax] mismatch in checksums! [aax] error in drm blob decryption! sample_size = %u sample_count = %u Invalid sample field size %u Duplicated STSZ atom STSZ atom truncated Invalid sample size %d reached eof, corrupted STSZ atom end_index >= 0 && end_index <= st->nb_index_entriessc->stsc_data[index].first <= sc->chunk_countfrag_stream_infostream %d, timestamp %lld, sample %d stream %d, found sample %d next == (int)nextignoring 'frma' atom of '%.4s', stream has codec id %d ignoring 'frma' atom of '%.4s', stream format is '%.4s' The 'keys' atom with the invalid key count: %u The key# %u in meta has invalid size:%u premiere_versionquicktime_versionwarningURLsubtitleoriginal_sourceplayback_requirementsperformersproduceroriginal_artistmodelmakehost_computergroupingoriginal_formatedit_datedisclaimerdirectorchapterseason_numbernetworkepisode_sortepisode_idmedia_typesort_showsort_namesort_composersort_artistsort_albumsort_album_artistpurchase_dategapless_playbackpodcastsynopsiskeywordshd_videofirmwareepisode_uiddescriptioncategoryaccount_idaccount_typeloci too short place name too long loci too short (%u bytes left, need at least %d) %+08.4f%+09.4f%+f%s-%sUnknown cover type: 0x%x. The index of 'data' is out of range: %d < 1 or >= %d. UDTA parsing failed retrying raw %.4sFailed to store the number (%d) in string. Failed to store the number (%u) in string. Failed to store the float32 number (%f) in string. HandBrake %d.%d.%dError parsing cover art. Missing schm or tenc failed to read the initialization vector hit EOF while reading sub-sample encryption info Multiple auxiliary info chunks are not supported Failed to seek for auxiliary info, will only parse senc atoms for encryption info Hit EOF while reading auxiliary info Ignoring duplicate encryption info in saio Duplicate saio atom Ignoring saio box with non-zero aux_info_type Ignoring saio box with non-zero aux_info_type_parameter Saw encrypted saio without schm/tenc Hit EOF while reading saio Ignoring duplicate encryption info in saiz Duplicate saiz atom Ignoring saiz box with non-zero aux_info_type Ignoring saiz box with non-zero aux_info_type_parameter Saw encrypted saiz without schm/tenc Failed to read the auxiliary info Ignoring duplicate encryption info in senc Hit EOF while reading senc Aneviatruncated extradata ignored unknown aclr value (%d) aclr not decoded - incomplete atom aclr not decoded - unable to add atom to extradata aclr not decoded - unexpected size %lld size: %dx%d palette: %06x%screation_time is not representable Invalid mvhd time scale %d, defaulting to 1 time scale = %i Multiple mdhd? Version %dInvalid mdhd time scale %d, defaulting to 1 Invalid sample rate %d Unsupported DTS audio channel layouttrack[%u].ctts.entries = %u ignoring CTTS entry with count=%d duration=%d count=%d, duration=%d CTTS invalid mov_update_dts_shift(): dts_shift set to %d reached eof, corrupted CTTS atom dts shift %d Invalid decryption key len %d expected %d error reading header moov atom not found on_parse_exit_offset=%lld Failed to retrieve first frame ignoring stream duration which is shorter than chapters Chapter %d not found in file %02d:%02d:%02d%c%02dstream %d, timescale not set Forcing full parsing for mp3 stream Overflow during bit rate calculation %lld * 8 * %d Referenced QT chapter track not found trun track id unknown, no tfhd was found index_entry_pos <= st->nb_index_entriesflags 0x%x entries %u found mfra time %lld, using it for pts found mfra time %lld, using it for dts found sidx time %lld, using it for pts found tfdt time %lld, using it for dts found track end time %lld, using it for dts first sample flags 0x%x Failed to add index entry pts %lld calculated dts %lld sc->dts_shift %d ctts.duration %d sc->time_offset %lld flags & MOV_TRUN_SAMPLE_CTS %d AVIndex stream %d, sample %d, offset %llx, dts %lld, size %u, distance %d, keyframe %d reached eof, corrupted TRUN atom stream %d, missing mandatory atoms, broken header stream %d, contradictionary STSC and STCO multiple edit list entries, Use -advanced_editlist to correctly decode otherwise a/v desync might occur STSZ sample size %d invalid (too large), ignoring STSZ sample size %d invalid (too small), ignoring wrong sample count Sample size %u is too large AVIndex stream %d, sample %u, offset %llx, dts %lld, size %u, distance %u, keyframe %d Invalid SampleDelta %d in STTS, at %d st:%d error unaligned chunk Zero bytes per frame, but %d samples per framewrong chunk count %u AVIndex stream %d, chunk %u, offset %llx, dts %lld, size %u, duration %u Cannot allocate index ranges buffer Shifting DTS by %d because of negative CTTS. st: %d edit list: %lld Missing key frame while searching for timestamp: %lld st: %d edit list %lld Cannot find an index entry before timestamp: %lld. stts: %lld ctts: %lld, ctts_index: %lld, ctts_count: %lld Cannot add CTTS entry %lld - {%lld, %d} skip %d audio samples from curr_cts: %lld drop a frame at curr_cts: %lld @ %lld Cannot reallocate frame duration buffer Cannot add index entry Support for mvhd.timescale = 0 with editlistsProcessing st: %d, edit list %lld - media time: %lld, duration: %lld Offset DTS by %lld to make first pts zero. Setting codecpar->delay to %d for stream st: %d stream %d, error opening alias: path='%s', dir='%s', filename='%s', volume='%s', nlvl_from=%d, nlvl_to=%d Skipped opening external track: stream %d, alias: path='%s', dir='%s', filename='%s', volume='%s', nlvl_from=%d, nlvl_to=%d.Set enable_drefs to allow this. stream %d, offset 0x%llx: partial file Nonkey frame from stream %d discarded due to AVDISCARD_NONKEY Cannot append palette to packet saiz atom found without saio saio atom found without saiz Incorrect number of samples in encryption info Only the 'cenc' encryption scheme is supported subsample size exceeds the packet size left leftover packet bytes after subsample processing c->fc->nb_streams >= 1invalid size %lld in stsd multiple fourcc not supported size=%lld 4CC=%s codec_type=%d Planar Y'CbCr 8-bit 4:2:0Sorenson H263audio channels %d version =%d, isom =%d reel_namereached eof, corrupted STSD atom invalid STSD entries %d Duplicate stsd found in this track. mov,mp4,m4a,3gp,3g2,mj2mov,mp4,m4a,3gp,3g2,mj2,psp,m4b,ism,ismv,isma,f4vuse_absolute_pathallow using absolute path when opening alias, this is a possible security issueseek_streams_individuallySeek each stream individually to the closest pointignore_editlistIgnore the edit list atom.advanced_editlistModify the AVIndex according to the editlists. Use this option to decode in the order specified by the edits.ignore_chaptersuse_mfra_foruse mfra for fragment timestampsexport_allExport unrecognized metadata entriesexport_xmpExport full XMP metadataactivation_bytesSecret bytes for Audible AAX filesaudible_fixed_keyFixed key used for handling Audible AAX files77214d4b196a87cd520045fd20a51d67decryption_keyThe media decryption key (hex)enable_drefsEnable external track support.degqluy}~dertx|dew{derltx|  o77p3~??`V'.}777&??n77yz{|7m7uvwx  kl3st  qr efjhig` dchan: layout=%u bitmap=%u num_descr=%u reached EOF while reading channel layout  =Nyuv2yuvs2vuy&raw 'L555%L565$B565b16graw 24BGraw BGRA RGBA ABGR "b48r0mBDW     Ԁ~9FT&˞F   encd 0ݺ/ fP.mp3Pmp4aavc1jVP6A\VP6Favc1 mp4vPmp4aPalacPac-3ptx3gptext%Pwma mp4vavc1avc3hev1hvc1mp4vmp4vmp4v=mp4vXmp4vFvc-1tdracmp4vvp09av01Pmp4a-Pmp4aPmp4aPmp4aPac-3(Pec-3Pmp4a,Pmlpa PfLaC 3gp3g2movipodismvEmpty MOOV enabled; disabling automatic bitstream filtering Global SIDX enabled; Ignoring skip_sidx option No meaningful edit list will be written when using empty_moov without delay_moov Edit list enabled; Assuming writing CMAF Track File Sample interleaving in fragments is mutually exclusive with omit_tfhd_offset and separate_moof muxer does not support non seekable output You requested a copy of the original timecode track so timecode metadata are now ignored Invalid encryption key len %d expected %d Invalid encryption kid len %d expected %d unsupported encryption scheme %s m4am4vWarning, extension is not .m4a nor .m4v Quicktime/Ipod might not play the file unsupported height for dv codec %s rawvideo cannot be written to mov, output file will be unreadable Using MS style video codec tag, the file may be unplayable! Using MS style audio codec tag, the file may be unplayable! Could not find tag for codec %s in stream #%d, codec not currently supported in container D-10/IMX must use 720x608 or 720x512 video resolution Warning: some tools, like mp4split, assume a timescale of 10000000 for ISMV. Resolution %dx%d too large for mov/mp4 WARNING codec timebase is very high. If duration is too long, file may not be playable by quicktime. Specify a shorter timebase or choose different container. %s only supported in MP4. VP8 muxing is currently not supported. track %d: codec frame size is not set track %d: codec block align is not set for adpcm track %d: muxing mp3 at %dhz is not standard, to mux anyway set strict to -1 track %d: muxing mp3 at %dhz is not standard in MP4 %s in MP4 support is experimental, add '-strict %d' if you want to use it. Lucida Grande3gp63gp43g2b3g2aM4V M4A PSP mode need one video and one audio stream Frame rate %f outside supported range yrrcengalbmCannot write moov atom before EAC3 packets parsed. next_dts >= 0libavformat/movenc.cnext_dts <= 0x7fffffff%s-malformed location metadata earthtrknCodecPrivateData dvvCdvcCXDCAM HD422 HD EX %d%cCould not locate DNxHD bit stream in vos_data Could not locate DNxHD bit stream, vos_data too small moov atom written before any packets, unable to write correct dvc1 atom. Set the delay_moov flag to fix this. DpxEgamma value %g writing gama value %d track->mode == 0x02gamma value unknown, unable to write gama atom Not writing 'gama' atom. Format is not MOV. no ICC profile found, will write nclx/nclc colour info instead track->mode == 0x02 || track->mode == 0x01Not writing 'colr' atom. Format is not MOV or MP4. Not writing 'clli' atom. No content light level info. Not writing 'mdcv' atom. Missing mastering metadata. Unsupported stereo_3d flags %x. st3d not written. Unsupported stereo_3d type %s. st3d not written. Unsupported projection %d. sv3d not written. DOVI in %s box, version: %d.%d, profile: %d, level: %d, rpu flag: %d, el flag: %d, bl flag: %d, compatibility id: %d Cannot write moov atom before AC3 packets. Set the delay_moov flag to fix this. perftitlgnredscpcprtARTnamautalbdayswrdescmtgencpymakmodxyzkeyaARTwrttoogrplyrdescldestvshtventvnnkeywtvestvsnstikhdvdpgapcpiltmpoinvalid extradata size Cannot write moov atom before TrueHD packets. Set the delay_moov flag to fix this. not writing 'chan' tag due to lack of channel information track width is too large track height is too large EDTS using dts:%lld cts:%d instead of dts:%lld cts:%lld tid:%d av_rescale_rnd(start_dts, 1000, track->timescale, AV_ROUND_DOWN) <= 0Not writing any edit list even though one would have been required FATAL error, file duration too long for timebase, this file will not be playable with QuickTime. Choose a different timebase with -video_track_timescale or a different container format fps %d is too large reel_name length %llu is too large track->par->codec_id == AV_CODEC_ID_OPUS || track->par->codec_id == AV_CODEC_ID_AACLavc58.91.1002006/04/01 11:11:11Unable to re-open %s output file for the second pass (faststart) Estimating the duration of the last packet in a fragment, consider setting the duration field in AVPacket instead. Unable to write PRFT, no entries in the track Unable to write PRFT, first PTS is invalid Unsupported PRFT box configuration: %d fatal error, input is not a single packet, implement a AVParser for it fatal error, input packet contains no samples Track %d starts with a nonzero dts %lld, while the moov already has been written. Set the delay_moov flag to handle this case. pts has no value Starting second pass: moving the moov atom to the beginning of the file reserved_moov_size is too small, needed %lld additional Starting second pass: inserting sidx atoms widefreepalette:%06x, %06x, %06x, %06x, %06x, %06x, %06x, %06x, %06x, %06x, %06x, %06x, %06x, %06x, %06x, %06xsize: <%s systemBitrate="%lld"> systemBitratetrackIDsystemLanguage_%s_cc_adtrackNameH264FourCCWVC1MaxWidthMaxHeightDisplayWidthDisplayHeightAACPAACHAACLWMAPAudioTagChannelsSamplingRateBitsPerSamplePacketSize application/f4vf4v muxervideo/mp4ismv,ismaismv muxerm4v,m4a,m4bipod muxertg2 muxermp4,psppsp muxermp4 muxertgp muxermov muxerMOV muxer flagsrtphintAdd RTP hint tracksmoov_sizemaximum moov size so it can be placed at the beginempty_moovMake the initial moov atom emptyfrag_keyframeFragment at video keyframesFragment at every frameseparate_moofWrite separate moof/mdat atoms for each trackFlush fragments on caller requestsismlCreate a live smooth streaming feed (for pushing to a publishing point)faststartRun a second pass to put the index (moov atom) at the beginning of the fileomit_tfhd_offsetOmit the base data offset in tfhd atomsdisable_chplDisable Nero chapter atomdefault_base_moofSet the default-base-is-moof flag in tfhd atomsWrite DASH compatible fragmented MP4cmafWrite CMAF compatible fragmented MP4frag_discontSignal that the next fragment is discontinuous from earlier onesDelay writing the initial moov until the first fragment is cut, or until the first fragment flushWrite a global sidx index at the start of the fileskip_sidxSkip writing of sidx atomwrite_colrWrite colr atom (Experimental, may be renamed or changed, do not use from scripts)prefer_iccIf writing colr atom prioritise usage of ICC profile if it exists in stream packet side datawrite_gamaWrite deprecated gama atomuse_metadata_tagsUse mdta atom for metadata.Skip writing the mfra/tfra/mfro trailer for fragmented filesnegative_cts_offsetsUse negative CTS offsets (reducing the need for edit lists)rtpflagsRTP muxer flagsUse MP4A-LATM packetization instead of MPEG4-GENERIC for AACrfc2190Use RFC 2190 packetization instead of RFC 4629 for H.263skip_rtcpDon't send RTCP sender reportsh264_mode0Use mode 0 for H.264 in RTPsend_byeSend RTCP BYE packets when finishingskip_iodsSkip writing iods atom.iods_audio_profileiods audio profile atom.iods_video_profileiods video profile atom.Maximum fragment durationMinimum fragment durationfrag_sizeMaximum fragment sizeism_lookaheadNumber of lookahead entries for ISM filesvideo_track_timescaleset timescale of all video tracksOverride major branduse_editlistuse edit listfragment_indexFragment number of the next fragmentmov_gammagamma value for gama atomfrag_interleaveInterleave samples within fragments (max number of consecutive samples, lower is tighter interleaving, but with more overhead)encryption_schemeConfigures the encryption scheme, allowed values are none, cenc-aes-ctrThe media encryption key (hex)encryption_kidThe media encryption key identifier (hex)use_stream_ids_as_track_idsuse stream ids as track idswrite_tmcdforce or disable writing tmcdWrite producer reference time box with specified time sourceempty_hdlr_namewrite zero-length name string in hdlr atoms within mdia and minf atomsCENC-AVC: remaining size %d smaller than nal length+type %d CENC-AVC: nal size %d remaining %d Unable to initialize hinting of stream %d rtpo  Using MP3 TOC to seek; may be imprecise. Using scaling to seek VBR MP3; may be imprecise. invalid concatenated file detected - using bitrate for duration filesize and duration do not match (growing file?) Cannot determine file size, skipping TOC table. pad %d %d Skipping %d bytes of junk at %lld. Invalid frame size (%d): Could not seek to %lld. Failed to read frame size: Could not seek to %lld. mp3mp2,mp3,m2a,mpausetocuse table of contents  LavfInvalid ID3v2 version requested: %d. Only 3, 4 or 0 (disabled) are allowed. Invalid audio stream. Exactly one MP3 audio stream is required. Only audio streams and pictures are allowed in MP3. Attached pictures were requested, but the ID3v2 header is disabled. Unsupported number of channels, not writing Xing header. best_bitrate_idx >= 0libavformat/mp3enc.cLavc libmp3lameLavf lameUnsupported sample rate, not writing Xing header. Audio packet of size %d (starting with %08X...) is invalid, writing it anyway. Not enough memory to buffer audio. Skipping picture streams Too many samples of initial padding. Too many samples of trailing padding. audio/mpegMP3 muxerwrite_id3v1Enable ID3v1 writing. ID3v1 tags are written in UTF-8 which may not be supported by most software.write_xingWrite the Xing header containing file duration.wD}buffer underflow st=%d bufi=%d size=%d Invalid packet size %d %s in MPEG-1 system streams is not widely supported, consider using the vob or the dvd muxer to force a MPEG-2 program stream. Invalid sampling rate for PCM stream. Allowed sampling rates:At most 8 channels allowed for LPCM streams. Unsupported sample rate. Support for muxing audio codec %s not implemented. Unsupported audio codec. Must be one of mp1, mp2, mp3, 16-bit pcm_dvd, pcm_s16be, ac3 or dts. VBV buffer size not set, using default size of 230KB If you want the mpeg file to be compliant to some specification Like DVD, VCD or others, make sure you set the correct buffer size buffer size %d, too large Invalid media type %s for output stream #%d mux rate %d is too large packet ID=%2x PTS=%0.3f payload_size - stuffing_size <= av_fifo_size(stream->fifo)libavformat/mpegenc.cavail_data > 0bumping scr, scr:%f, dts:%f packet too large, ignoring buffer limits to mux it delay too large, ignoring ... av_fifo_size(stream->fifo) > 0avail_space >= s->packet_size || ignore_constraintsdts:%f pts:%f scr:%f stream:%d av_fifo_size(stream->fifo) == trailer_sizestream->premux_packetav_fifo_size(stream->fifo) == 0First SCR: %lld First DTS: %lld dts:%f pts:%f flags:%d stream:%d nopts:%d video/mpegdvd muxersvcdvobsvcd muxervob muxermpg,mpegmpeg muxermuxrateInitial demux-decode delay in microseconds.@ @ @ xxxxh264_mp4toannexbhevc_mp4toannexbFFmpegService%s%02dToo long service or provider name m2tsOnly one program is allowed in m2ts mode! Cannot automatically assign PID for stream %d Invalid stream id %d, must be less than 8191 Invalid PMT PID %d, must be less than %d PID %d cannot be both elementary and PMT PID Duplicate stream id %d frame size not set service %i using PCR in pid=%i, pcr_period=%lldms muxrate VBR, muxrate %d, sdt every %lld ms, pat/pmt every %lld ms ts_st->payload != buf || st->codecpar->codec_type != AVMEDIA_TYPE_VIDEOlibavformat/mpegtsenc.cThe PMT section cannot fit stream %d and all following streams. Try reducing the number of languages in the audio streams or the total number of streams. Stream %d, codec %s, is muxed as a private data stream and may not be recognized upon reading. Unsupported Opus Vorbis-style channel mappingUnsupported Opus channel mapping for family %dUnsupported Opus channel mappingID3 dts < pcr, TS is invalid pkt[3] & 0x20H.264 bitstream malformed, no startcode found, use the video bitstream filter 'h264_mp4toannexb' to fix it ('-bsf:v h264_mp4toannexb' option with ffmpeg) H.264 bitstream error, startcode missing, size %d data %08Xfirst pts value must be set nal %d AAC packet too short AAC bitstream not in ADTS format and extradata missing pkt->dts != ((int64_t)0x8000000000000000ULL)HEVC bitstream malformed, no startcode found HEVC bitstream error, startcode missing, size %dOpus packet too short Opus packet duration > 120 ms, invalid2 + pkt->size / 255 + 1 == iGot MPEG-TS formatted Opus data, unhandled!ts_st->payload_sizevideo/MP2Tts,m2t,m2ts,mtsMPEGTS muxermpegts_transport_stream_idSet transport_stream_id field.mpegts_original_network_idSet original_network_id field.mpegts_service_idSet service_id field.mpegts_service_typeSet service_type field.digital_tvDigital Television.teletextTeletext.advanced_codec_digital_radioAdvanced Codec Digital Radio.mpeg2_digital_hdtvMPEG2 Digital HDTV.advanced_codec_digital_sdtvAdvanced Codec Digital SDTV.advanced_codec_digital_hdtvAdvanced Codec Digital HDTV.hevc_digital_hdtvHEVC Digital Television Service.mpegts_pmt_start_pidSet the first pid of the PMT.mpegts_start_pidSet the first pid.mpegts_m2ts_modeEnable m2ts mode.pes_payload_sizeMinimum PES packet payload in bytesMPEG-TS muxing flagsReemit PAT/PMT before writing the next packetUse LATM packetization for AACpat_pmt_at_framesReemit PAT and PMT at each video framesystem_bConform to System B (DVB) instead of System A (ATSC)initial_discontinuityMark initial packets as discontinuousmpegts_copytsdon't offset dts/ptstables_versionset PAT, PMT and SDT versionomit_video_pes_lengthOmit the PES packet length for video packetspcr_periodPCR retransmission time in millisecondsPAT/PMT retransmission time limit in secondsSDT retransmission time limit in secondsContent-type: image/jpeg Content-length: %d --%s mpjpegmultipart/x-mixed-replace;boundary=ffmpegmjpgmpjpeg_muxerboundary_tagBoundary tagwrite_packet_commonNOPTSfailed to avoid negative pts %s in stream %d. Try -avoid_negative_ts 1 as a possible workaround. Packets poorly interleaved, failed to avoid negative timestamp %s in stream %d. Try -max_interleave_delta 0 as a possible workaround. pkt->size == sizeof(*frame)libavformat/mux.cInvalid packet stream index: %d Received a packet for an attachment stream. Requested output format '%s' is not a suitable output format Unable to find a suitable output format for '%s' Out of memory The AVFormatContext is not in set to bitexact mode, only the AVCodecContext. If this is not intended, set AVFormatContext.flags |= AVFMT_FLAG_BITEXACT. No streams to mux were specified Using AVStream.codec to pass codec parameters to muxers is deprecated, use AVStream.codecpar instead. sample rate not set dimensions not set Aspect ratio mismatch between muxer (%d/%d) and encoder layer (%d/%d) Tag %s incompatible with output codec id '%d' (%s) encoder-Delay between the first packet and last packet in the muxing queue is %lld > %lld: forcing output %s size:%d dts:%s pts:%s Timestamps are unset in a packet for stream %d. This is deprecated and will stop working in the future. Fix your code to set the timestamps properly compute_muxer_pkt_fields: pts:%s dts:%s cur_dts:%s b:%d size:%d st:%d Packet with invalid duration %lld in stream %d Encoder did not produce proper pts, making some up. Application provided invalid, non monotonically increasing dts to muxer in stream %d: %s >= %s pts (%s) < dts (%s) in stream %d av_write_frame: pts2:%s dts2:%s Failed to send packet to filter %s for stream %d Error applying bitstream filters to an output packet for stream #%d: %s av_interleaved_write_frame FLUSH s->oformatABGRARGBBGRBGRARGB7FRGB"RrGgBb"RGB#rRgGbB&FRGB$RGBRGBA PA]0u0  2 < `H@KZ_`wdx+4AVup+4 +4 +4+4+4+4+4  +4 +4X+4 F+4 F+4 F+4 F+4 F+4 F+4 F+4 F+4  F+4  F+4 +4  +4q c+4c+4c+4 2+4 1+4 +4+4 +4P+4 +4 +4~ +4+4P+4P+4 +4 +4 }`>oooxl+4 +4S  +4 D$/%Mǒ)+4S +4S \+4+4+4+4+4+4+4+4S Q+4S B+4S H+4S G+4+4S n+4S (+4+4+4+4+4+4+4 +4 +4 +4 +4 +4  cX +4 +4 +4 +4  +4  <+4;+4;+4;+4;+4;+4 ;+4 ;+4 ;+4 <+4 <+4 <+4 <+4 <+4 <+4 <+4<+4  <+4 +4+4'+4?+4D+4D+4D+4D+4D+4G+4H+4H+4K+40K+4H+4+4+4+4 +4+4+4+4+4+4?+4 0+40+40+40+4 2+4 2+42+42+42+42+42+42+4 2+4 2+4 2+4 2+4 2+42+42+42+42+42+42+42+42+43+4 3+43+43+43+43+43+43+4=+4=+4=+4=+4=+4=+4 ?+40 ?+4 ?+4?+4?+4?+4 ?+4 ?+4+4 +4+4+4+4 +4 =+4 =+4D+4 P+4 P+4 +4 +4+4 +4 L+4+4 +4 +4+4+4+4+4+4+4+4+4+4+4 q+4 q+4 q+4 q+4 q+4 q +4 q +4 q+4 q+4 q+4 q+4 q+4 q+4 q+4 q+4 q$+4 q%+4 q&+4 q'+4 q(+4 +4 +4 +4 +4 +4 +4 +4+4 +4+4 @+4+4 A+4+4 P+4+4 Q+4+4 `+4+4 a+4+4 b+4+4 c+4+4 1B+4 1 M+4 10X+4 1@d+4 1Pn+4 1`z+4 1p+4 2 n+4 2!n+4 2!Jn+4 2!n+4 2!Jn+4 2!n+4 2! &n+4 20z+4 216z+4 21z+4 216z+4 21z+4 21z+4 21 Xz+4 2@+4 2P,+4 +4 +4C Invalid UTF8 sequence in mxf_utf16len utf16 local tag size %llx invalid (too large), ignoring essence container count:%d edit units count %d missing frames the number of audio channels shall be 4 or 8 : the output will not comply to MXF D-10 specs, use -d10_channelcount to fix this d10_channelcount < actual number of audio channels : some channels will be discarded d10_channelcount shall be set to 4 or 8 : the output will not comply to MXF D-10 specs out st:%d dts:%lld Unsupported frame rate %d/%d. Set -strict option to 'unofficial' or lower in order to allow it! Unofficial frame rate %d/%d. there must be exactly one stream for mxf opatom comment_there must be exactly one video stream and it must be the first one error MXF D-10 only support MPEG-2 Video error MXF D-10 only support 30/40/50 mbit/s only 48khz is implemented MXF D-10 only support one audio track MXF D-10 only support 16 or 24 bits le audio Only pcm_s16le and pcm_s24le audio codecs are implemented MXF OPAtom only supports single channel audio r=%d/%ddata_typevbi_vanc_smpte_436Mtrack %d: unsupported data type data track must be placed last track %d: could not find essence container ul, codec not currently supported in container OP1a MuxerOPAtom Muxer0.0.0material_package_namefile_package_nametoo many tagged values, ignoring remaining package type:%d could not allocate index entries error parsing mpeg2 frame could not get mpeg2 profile and level source marked as interlaced but codec profile is progressive error parsing sps h264 profile not supported track %d: frame size does not match index unit size, %d != %d No packets in first stream could not get dnxhd profile could not get prores profile could not get h264 profile mxf_opatomapplication/mxfmxf_d10MXF-OPAtom muxermxf_audio_edit_rateAudio edit rate for timecodesignal_standardForce/set Signal Standardbt601ITU-R BT.601 and BT.656, also SMPTE 125M (525 and 625 line interlaced)bt1358ITU-R BT.1358 and ITU-R BT.799-3, also SMPTE 293M (525 and 625 line progressive)smpte347mSMPTE 347M (540 Mbps mappings)smpte274mSMPTE 274M (1125 line)smpte296mSMPTE 296M (750 line progressive)smpte349mSMPTE 349M (1485 Mbps mappings)smpte428SMPTE 428-1 DCDMstore_user_commentsMXF-D10 muxerd10_channelcountForce/set channelcount in generic sound essence descriptorMXF muxer%s: Address %s port %s Failed to set close on exec setsockopt(SO_REUSEADDR) failed ff_socket_nonblock failed Connection to %s failed (%s), trying next address Connection to %s failed: %s Original list of addressesInterleaved list of addressesStarting connection attempt to %s port %s Connected attempt failed: %s nb_attempts > 0libavformat/network.cSuccessfully connected to %s port %s Connection attempt to %s port %s failed: %s *nulldefaultduboriginalcommentlyricskaraoke  DFPPFD @DFPPFD@DSPPSD DSP PSD  DSPPSD @DSPPSD@PSDDUPPUDDUPPUD  DUP PUD PUDPSPPSPPSPPSPPSP =P3389ALAWULAWPMP3 frame_code['N'].flags == FLAG_INVALIDlibavformat/nutenc.cMultiple keyframes with same PTS nus->keyframe_pts[k] > last_ptsNegative pts not supported stream %d, pts %lld Try to enable the genpts flag nus->last_pts != ((int64_t)0x8000000000000000ULL)frame_code != -1video/x-nutnutencsyncpointsNUT syncpoint behaviourdefaultDisable syncpoints, low overhead and unseekabletimestampedExtend syncpoints with a wallclock timestampwrite_indexWrite indextheoraThe pagesize option is deprecated Unsupported codec id in stream %d No extradata present FLACfLaCOpusTagsVP80Changing time base from %d/%d to %d/%d Extradata corrupted theora kfgshift %d, vrev %d Error writing FLAC headers Error writing Speex headers Error writing Opus headers Error writing VP8 headers audio/oggOgg Opus muxerspxOgg Speex muxerogvvideo/oggOgg video muxerogaOgg audio muxerapplication/oggOgg muxerserial_offsetserial number offsetoggpagesizeSet preferred Ogg page size.preferred page size in bytes (deprecated)page_durationpreferred page duration, in microseconds???P'PPX!X"@rSample rate %d not supported in OpenMG audio ea3ATRAC3 in OMA is only supported with 2 channels ATRAC3: Unsupported extradata size unsupported codec tag %s for write audio/x-omaAVFormatContextavioflagsdirectreduce bufferingset probing sizeformatprobesizenumber of bytes to probe file formatpacketsizeset packet sizeflush_packetsreduce the latency by flushing out packets immediatelyignidxignore indexgenptsgenerate ptsnofillindo not fill in missing values that can be exactly calculatednoparsedisable AVParsers, this needs nofillin tooigndtsignore dtsdiscardcorruptdiscard corrupted framessortdtstry to interleave outputted packets by dtskeepsidedeprecated, does nothingfastseekfast but inaccurate seeksnobufferreduce the latency introduced by optional bufferingbitexactdo not write random/volatile datashorteststop muxing with the shortest streamadd needed bsfs automaticallyseek2anyallow seeking to non-keyframes on demuxer level when supportedanalyzedurationspecify how many microseconds are analyzed to probe the inputcryptokeydecryption keyindexmemmax memory used for timestamp index (per stream)rtbufsizemax memory used for buffering real-time framesfdebugprint specific debug infomax_delaymaximum muxing or demuxing delay in microsecondsstart_time_realtimewall-clock time when stream begins (PTS==0)fpsprobesizenumber of frames used to probe fpsaudio_preloadmicroseconds by which audio packets should be interleaved earliermicroseconds for each chunkchunk_sizesize in bytes for each chunkf_err_detectset error detection flags (deprecated; use err_detect, save via avconv)set error detection flagscrccheckverify embedded CRCsdetect bitstream specification deviationsdetect improper bitstream lengthexplodeabort decoding on minor error detectionignore_errignore errorscarefulconsider things that violate the spec, are fast to check and have not been seen in the wild as errorscompliantconsider all spec non compliancies as errorsaggressiveconsider things that a sane encoder shouldn't do as an erroruse_wallclock_as_timestampsuse wallclock as timestampsskip_initial_bytesset number of bytes to skip before reading header and framescorrect_ts_overflowcorrect single timestamp overflowsenable flushing of the I/O context after each packetmetadata_header_paddingset number of bytes to be written as padding in a metadata headeroutput_ts_offsetset output timestamp offsetmax_interleave_deltamaximum buffering duration for interleavingf_stricthow strictly to follow the standards (deprecated; use strict, save via avconv)how strictly to follow the standardsstrictly conform to a older more strict version of the spec or reference softwarestrictly conform to all the things in the spec no matter what the consequencesnormalunofficialallow unofficial extensionsexperimentalallow non-standardized experimental variantsmax_ts_probemaximum number of packets to read while waiting for the first timestampavoid_negative_tsshift timestamps so they start at 0enabled when required by target formatdisableddo not change timestampsmake_non_negativeshift timestamps so they are non negativemake_zeroset information dump field separatorcodec_whitelistList of decoders that are allowed to be usedformat_whitelistList of demuxers that are allowed to be usedmax_streamsmaximum number of streamsskip_estimate_duration_from_ptsskip duration calculation in estimate_timings_from_ptsmax_probe_packetsMaximum number of packets to probe a codecvidcmulawalawu16leuwu16beu24leu24beu32leu32bes8sbs16lesws16bes24les24bes32les32bef32lef32bef64lef64beUUUdFdV,q:@@@f3̙f3f3ffffff3f3333f333f3f3̙f3̙̙̙̙f̙3̙ffffff3f3333f333f3̙f3̙̙f3̙f3ff̙ffff3f33̙33f333̙f3ffffff3ffff̙fff3fffffff3ffffffffffff3fff3f3f3f3ff33f3ffffff3f3333f333333̙3f3333333f3333f3f3f3ff3f33f33333333f333333333f333f3̙f3f3ffffff3f3333f333f3wUD"wUD"wUD"ݻwwwUUUDDD"""raw_packet_size25%s files have exactly one stream %s files have exactly one audio stream %s files have exactly one video stream truehdthdaudio/x-sbcsbc,msbcrawvideoyuv,rgbmpeg2videom2vmpeg1videompg,mpeg,m1vmp2mp2,m2a,mpamlpsinglejpegimage/jpegvideo/x-mjpegmjpg,mjpeghevchevc,h265,265h264h264,264video/x-h263video/x-h261audio/x-gsmg726leg726g723_1audio/g723tco,rcog722audio/G722audio/x-eac3audio/x-dcadnxhddnxhd,dnxhrdiracdrc,vc2codec2rawcavsvideocavsavs,avs2aptx_hdaptxhdaptxadxaudio/x-ac3REPLAYGAIN_TRACK_GAINREPLAYGAIN_TRACK_PEAKREPLAYGAIN_ALBUM_GAINREPLAYGAIN_ALBUM_PEAKP,mF_l'P#XqDbXBG6MaeOl(P-B͓;P+mF_l jEVӳ $P   P"P1P2 84PB E  @PPPU W Xab di?Pu5PP4P)P0X5P`Pa%Pb&Pc Xe Xf PPPpP:PAPAPPPP1PP (P P XH XH ulPmpPCA@JY5Pr4PP#P P FSPoVHEVCH265H264h264X264x264avc1DAVCSMV2VSSHQ264V264GAVCUMSVtshdINMCH263X263T263L263VX1KZyGoM263lsvmH263I263H261U263VSM4 FMP4 DIVX DX50 XVID MP4S M4S2  ZMP4 DIV1 BLZ0 mp4v UMP4 WV1F SEDG RMP4 3IV2 WAWV FFDS FVFW DCOD MVXM PM4V SMP4 DXGM VIDM M4T3 GEOX G264 HDX4 DM4V DMK2 DYM4 DIGI EPHV EM4A M4CC SN40 VSPX ULDX GEOV SIPP SM4V XVIX DreX QMP4 PLV1 GLV4 GMP4 MNM4 GTM4MP43DIV3MPG3DIV5DIV6DIV4DVX3AP41COL1COL0MP42DIV2MPG4MP41WMV1WMV2GXVEdvsddvhddvh1dvsldv25dv50cdvcCDVHCDV5dvc dvcsdvh1dvispdvcSL25SLDVAVd1mpg1mpg2MPEGPIM1PIM2VCR2 DVR MMESLMP2slifEM2VM701M702M703M704M705mpgvBW10XMPGMJPGMSC2LJPGdmb1mjpaJR24 LJPGJPGL MJLS MJPGMJLSjpegIJPG AVRnACDVQIVGSLMJCJPGIJLVMVJPAVI1AVI2MTSJZJPGMMJPHFYUCFFVHCYUV  I420 YUY2 Y422 V422 YUNV UYNV UYNY uyv1 2Vu1 2vuy yuvs yuv2 P422 YV12 YV16 YV24 UYVY VYUY IYUV Y800 Y8 HDYC YVU9 VDTZ Y411 NV12 NV21 Y41B Y42B YUV9 YVU9 auv2 YVYU YUYV I410 I411 I422 I440 I444 J420 J422 J440 J444 YUVA I40A I42A RGB2 RV15 RV16 RV24 RV32 RGBA AV32 GREY I09L I09B I29L I29B I49L I49B I0AL I0AB I2AL I2AB I4AL I4AB I4FL I4FB I0CL I0CB I2CL I2CB I4CL I4CB I0FL I0FBFRWUR10kr210v210C210v308v408AYUVv410yuv4IV31IV32oIV41pIV50VP31VP30-VP40ZVP50[VP60[VP61[VP62jVP6A\VP6F\FLV4VP70VP71VP80VP90ASV1 ASV2#VCR1!FFV1)XxanqLM20-mrle--.MSVC.msvc.CRAM.cram.WHAM.wham+cvid3DUCK3PVEZ5MSZH6ZLIB SNOW"4XMVFLV1S263VFSV1svq18tscc9ULTI;VIXL<QPEG<Q1.0<Q1.1GWMV3WMVPFWVC1FWMVAWVP2HLOCOIWNV1IYUV8JAAS4JAASCKRT21LFPS1theoMTM20TR20OCSCDQZMBVUKMVCWCAVSAVS2Xmjp2XMJ2CXLJ2CXLJ2KXIPJ2XAVj2YVMnc]tga =MPNG=PNG1=png $CLJRtdrac*azpr*RPZA*rpza SP54{AURA|AUR2dpx KGV1LAGSkAMVFULRAULRGULY0ULY2ULY4ULH0ULH2ULH4UQY0UQY2UQRAUQRGUMY2UMH2UMY4UMH4UMRAUMRGVBLEE130xtorZECOY41P2AFLCMSS1MSA1TSC2MTS2CLLCMSS2SVQ3012va12vG2M2G2M3G2M4G2M5FICVCHQXTDSCCUVCERV40SPV1RSCCISCCCFHDM101M102MAGYM8RGM8RAM8G0M8Y0M8Y2M8Y4M8YAM0RAM0RGM0G0M0Y2M0Y4M2RAM2RGYLC0SHQ0SHQ1SHQ2SHQ3SHQ4SHQ5SHQ7SHQ9FMVCSCPRUCODAV01MSCC SRGC$IMM4%BT20&MWSC'WCMV(RASC)HYMT*ARBC+AGM0+AGM1+AGM2+AGM3+AGM4+AGM5+AGM6+AGM7,LSCR.IMM5/MVDV0MVHA2MV303nlc1IARTICMTICOPICRDIGNRILNGINAMIPRDIPRTITRKISFTISMPITCH!D8qwav header size < 14WAVEFORMATEX support for RIFX filesunknown subformat:%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x {%02x%02x%02x%02x-%02x%02x-%02x%02x-%02x%02x-%02x%02x%02x%02x%02x%02x} Invalid sample rate: %d INFO subchunk truncated too big INFO subchunk truncated file out of memory, unable to read INFO tag premature end of file while reading INFO tag IARLIARTIAS1IAS2IAS3IAS4IAS5IAS6IAS7IAS8IAS9ICMSICMTICOPICRDICRPIDIMIDPIIENGIGNRIKEYILGTILNGIMEDINAMIPLTIPRDIPRTITRKISBJISFTISHPISMPISRCISRFITCH(start&1) == 0libavformat/riffenc.cBottomUprequested bits_per_coded_sample (%d) and actually stored (%d) differ RV10RV20RVTRDRV30ERV40Pdnet0lpcJ028_8PcookPatrc)PsiprPraacPracp9PLSD:CLV1Muxing packets larger than 64 kB (%d) is not supported audio/x-pn-realaudioThe Audio Streamvideo/x-pn-realvideoThe Video Stream.raInt0Invalid codec tag Frame rate %d is too high At most 2 streams are currently supported for muxing in RM application/vnd.rn-realmediarm,raOutput file is too big (%lld bytes >= 64kB) RSO only supports mono Sample rate must be < 65536 ADPCM in RSOrsoPCMU@GSM@G7234P@DVI4@DVI4>LPC@PCMA@ G722@ L16D L16D QCELPP@ CN@MPAPMPAPG728@DVI4+DVI4"VG729@CelB_JPEG_nv_H261_ MPV_ MPV_!MP2T_"H263_payload_typeRTCP: %02x %llx %x Only one stream supported in the RTP muxer Max packet size %u too low Packetizing VC-2 is experimental and does not use all values of the specification (even though most receivers may handle it just fine). Please set -strict experimental in order to enable it. Packetizing H.261 is experimental and produces incorrect packetization for cases where GOBs don't fit into packets (even though most receivers may handle it just fine). Please set -f_strict experimental in order to enable it. Packetizing VP9 is experimental and its specification is still in draft state. Please set -strict experimental in order to enable it. Multistream opus not supported in RTP Incorrect iLBC block size specified RTP max payload size too small for AMR Only mono is supported rtp_send_data size=%d %d: write len=%d Packet size %d too large for max RTP payload size %d RTP muxerSpecify RTP payload typessrcStream identifiercnameCNAME to include in RTCP SR packetsseqStarting sequence numberRTP/H.261 packet not cut at a GOB boundary, not signaled correctly Unable to split H.263 packet, use -mb_info %d or -ps 1. Sending NAL %x of len %d M=%d NAL size %d > %d, try -slice-max-size %d NAL size %d > %d Unsupported pixel format Only 8-bit precision is supported. Too short JPEG header. Aborted! Invalid number of quantisation tables Only 1x1 chroma blocks are supported. Aborted! Insufficient data. Aborted! RFC 2435 requires standard Huffman tables for jpeg RFC 2435 suggests two quantization tables, %d provided rtp_mpegtsVC-2 parse code %d&udpbuffer_size=%dpkt_size=%ddscp=%dfifo_size=0sources=%sblock=%sttllocalportlocalrtpportlocalrtcpportpkt_sizewrite_to_sourcesourcesblockFailed to parse the FEC protocol value prompegUnsupported FEC protocol %s Failed to parse the FEC options Data doesn't look like RTP packets, make sure the RTP muxer is used Unable to send packet to source, no packets received yet Not received any RTCP packets yet, inferring peer port from the RTP port Not received any RTP packets yet, inferring peer port from the RTCP port Failed to send FEC Time to live (in milliseconds, multicast only)Send/Receive buffer size (in bytes)rtcp_portCustom rtcp portlocal_rtpportLocal rtp portlocal_rtcpportLocal rtcp portConnect socketSend packets to the source address of the latest received packetMaximum packet sizeDSCP classSource listBlock listfecFEC/;,x-pn-tngx-real-rdt=;,client_portserver_portinterleavedgetaddrinfo(%s): %s ;, receivenpt=Failed to parse interval end specification '%s' %s %s RTSP/1.0 CSeq: %d If-Match:Session: %s Sending: %s-- Tunneling of RTSP requests with content datartptimeSession:;timeout=Content-Length:Transport:CSeq:Range:RealChallenge1:Server:X-Notice:Location:WWW-Authenticate:Authentication-Info:Content-Base:DESCRIBERTP-Info:PLAYPublic:GET_PARAMETEROPTIONSx-Accept-Dynamic-Rate:Content-Type:skipping RTP packet len=%d ret=%d c=%02x [%c] line='%s' RTSP/RTSP/1.0 200 OK RTSP/1.0 501 Not Implemented CSeq %d expected, %d received. method %s failed: %d%s RAW/RAWRTP/AVP/rtx?localport=%dUnable to open an input RTP port %s/UDP;unicast;client_port=%d%s/TCP;interleaved=%d-%d%s/UDP;multicast;mode=record;mode=playTransport: %s x-Dynamic-Rate: 0 SETUPNonmatching transport in server reply ?connect=1?ttl=%dInvalid UDP port range, max port %d less than min port %d rtspsUnsupported lower transport method, only UDP and TCP are supported for output. %08x%08xx-sessioncookie: %s Accept: application/x-rtsp-tunnelled Pragma: no-cache Cache-Control: no-cache x-sessioncookie: %s Content-Type: application/x-rtsp-tunnelled Pragma: no-cache Cache-Control: no-cache Content-Length: 32767 Expires: Sun, 9 Jan 1972 00:00:00 GMT ?timeout=%dClientChallenge: 9e26d33f2984236010ef6253fb1887f7 PlayerStarttime: [28/03/2003:22:50:23 00:00] CompanyID: KnKV4M4I/B2FjJ1TToLycw== GUID: 00000000-0000-0000-0000-000000000000 WMServer/Status %d: Redirecting to %s initial_pausedo not start playing the stream immediatelyrtsp_transportset RTSP transport protocolsUDPudp_multicastUDP multicastHTTP tunnelingHTTPS tunnelingrtsp_flagsset RTSP flagsfilter_srconly receive packets from the negotiated peer IPwait for incoming connectionsprefer_tcptry RTP via TCP first, if availableallowed_media_typesset media types to accept from the serverSubtitlemin_portset minimum local UDP portmax_portset maximum local UDP portlisten_timeoutset maximum timeout (in seconds) to wait for incoming connections (-1 is infinite, imply flag listen)set maximum timeout (in seconds) to wait for incoming connections (-1 is infinite, imply flag listen) (deprecated, use listen_timeout)stimeoutset timeout (in microseconds) of socket TCP I/O operationsreorder_queue_sizeset number of packets to buffer for handling of reordered packetsUnderlying protocol send/receive buffer sizeUnderlying protocol send packet sizeoverride User-Agent header (deprecated, use user_agent)TEARDOWNRange: npt=0.000- RECORDrtspSDP: %s Content-Type: application/sdp ANNOUNCE/streamid=%dRTSP muxerannounce_portsame_portannounce_addrUnable to resolve %s 224.2.127.254ff0e::2:7ffeHost %s resolved to unsupported address family ?ttl=%d&connect=1Unsupported protocol family application/sdpAnnouncement too large to send in one packet sapInsufficient timestamps. %02d:%02d:%02d:%02d SCC supports only a single subtitles stream. Unsupported subtitles codec: %s Scenarist_SCC V1.0 scc; sprop-parameter-sets=; profile-level-id=IP4c=IN %s %s/%d c=IN %s %s Unsupported Xiph codec ID Not enough memory for configuration string Too much extradata! Cannot allocate memory for the config info. ; config=srtpIP6applicationYCbCr-4:2:0YCbCr-4:2:2YCbCr-4:4:4vadoffQCIF=1m=%s %d RTP/AVP %d b=AS:%lld a=rtpmap:%d VC2/90000 Cannot allocate memory for the parameter sets. Cannot Base64-encode %td %td! a=rtpmap:%d H264/90000 a=fmtp:%d packetization-mode=%d%s a=rtpmap:%d H261/90000 a=fmtp:%d %s a=rtpmap:%d H263-2000/90000 a=framesize:%d %d-%d ; sprop-%s=a=rtpmap:%d H265/90000 a=rtpmap:%d MP4V-ES/90000 a=fmtp:%d profile-level-id=1%s a=rtpmap:%d MP4A-LATM/%d/%d a=fmtp:%d profile-level-id=%d;cpresent=0;config=%s AAC with no global headers is currently not supported. a=rtpmap:%d MPEG4-GENERIC/%d/%d a=fmtp:%d profile-level-id=1;mode=AAC-hbr;sizelength=13;indexlength=3;indexdeltalength=3%s a=rtpmap:%d L16/%d/%d a=rtpmap:%d L24/%d/%d a=rtpmap:%d PCMU/%d/%d a=rtpmap:%d PCMA/%d/%d a=rtpmap:%d AMR/%d/%d a=fmtp:%d octet-align=1 a=rtpmap:%d AMR-WB/%d/%d a=fmtp:%d octet-align=1 Vorbis configuration info missing a=rtpmap:%d vorbis/%d/%d a=fmtp:%d configuration=%s Unsupported pixel format. Theora configuration info missing a=rtpmap:%d theora/90000 a=fmtp:%d delivery-method=inline; width=%d; height=%d; sampling=%s; configuration=%s a=rtpmap:%d VP8/90000 a=rtpmap:%d VP9/90000 a=rtpmap:%d JPEG/90000 a=rtpmap:%d G722/%d/%d a=rtpmap:%d AAL2-G726-%d/%d a=rtpmap:%d G726-%d/%d a=rtpmap:%d iLBC/%d a=fmtp:%d mode=%d a=rtpmap:%d speex/%d a=fmtp:%d vbr=%s a=rtpmap:%d opus/48000/2 a=fmtp:%d sprop-stereo=1 Unsupported sample rate No Name127.0.0.1::1v=%d o=- %d %d IN %s %s s=%s t=%d %d a=tool:libavformat 58.45.100 srtp_out_suitesrtp_out_paramsa=crypto:1 %s inline:%s vpsppsUnable to re-open %s output file to write the header Sega FILM allows a maximum of one audio stream. Sega FILM allows a maximum of one video stream. Incompatible video stream format. Pixel format must be rgb24. No video stream present. Incompatible audio stream format. film_cpkFailed to open segment list '%s' #EXT-X-VERSION:3 #EXT-X-MEDIA-SEQUENCE:%d #EXT-X-TARGETDURATION:%lld ffconcat version 1.0 NOTE: the option initial_offset is deprecated,you can use output_ts_offset instead of it segment_time, segment_times, and segment_frames options are mutually exclusive, select just one of them Could not allocate forced times array Empty time specification in times list %s Invalid time duration specification '%s' in times list %s Specified time %f is greater than the following time %f Could not allocate forced frames array Empty frame specification in frame list %s Invalid argument '%s', must be a positive integer <= INT64_MAX Specified frame %d is greater than the following frame %d Invalid time duration specification '%s' for segment_time option Invalid negative segment_time with segment_atclocktime option set csvffcat,ffconcat'ext' list type option is deprecated in favor of 'csv' Could not select stream matching identifier '%s' format %s not supported. s->nb_streams == oc->nb_streamslibavformat/segment.cSelected stream id:%d type:%s ", ,%f,%f #EXTINF:%f, %s Error writing list entry '%s' in list file !"Invalid list type"Failure occurred when ending segment '%s' segment:'%s' count:%d ended Could not increment global timecode, error occurred during timecode creation. Could not increment global timecode, no global timecode metadata found. Could not increment stream %d timecode, error occurred during timecode creation. %.6gUnable to add extradata to stream. Output segments may be invalid. +resend_headerssegment:'%s' starts with packet stream:%d pts:%s pts_time:%s frame:%d stream:%d start_pts_time:%s pts:%s pts_time:%s dts:%s dts_time:%s -> pts:%s pts_time:%s dts:%s dts_time:%s stream_segment,ssegmentstream_segment muxerreference_streamset reference streamsegment_formatset container format used for the segmentssegment_format_optionsset list of options for the container format used for the segmentssegment_listset the segment list filenamesegment_header_filenamewrite a single file containing the headersegment_list_flagsset flags affecting segment list generationallow list cachingenable live-friendly list generation (useful for HLS)segment_list_sizeset the maximum number of playlist entriessegment_list_typeset the segment list typeflatflat formatcsv formatextended formatffconcat formatM3U8 formatApple HTTP Live Streaming compatiblesegment_atclocktimeset segment to be cut at clocktimesegment_clocktime_offsetset segment clocktime offsetsegment_clocktime_wrap_durationset segment clocktime wrapping durationsegment_timeset segment durationsegment_time_deltaset approximation value used for the segment timessegment_timesset segment split time pointssegment_framesset segment split frame numberssegment_wrapset number after which the index wrapssegment_list_entry_prefixset base url prefix for segmentssegment_start_numberset the sequence number of the first segmentsegment_wrap_numberset the number of wrap before the first segmentincrement_tcincrement timecode between each segmentbreak_non_keyframesallow breaking segments on non-keyframesindividual_header_trailerwrite header/trailer to each segmentwrite_header_trailerwrite a header to the first segment and a trailer to the last onereset_timestampsreset timestamps at the beginning of each segmentinitial_offsetset initial timestamp offsetwrite_empty_segmentsallow writing empty 'filler' segmentsAPCMNONEJFIF SMJPEGmore than >2 streams are not supported unsupported audio codec unsupported video codec smjpegmBDW %s/Manifest%s/Manifest.tmp %s/temp%s/FragmentInfo(%s=%llu)%s/Fragments(%s=%llu)calculating bitrate got zero. calculated bitrate: %lld %s/QualityLevels(%lld)mkdir failed %s/QualityLevels(Tmp_%d)Unsupported video codec Unsupported audio codec no video stream and no min frag duration set smoothstreamingsmooth streaming muxerlookahead_countnumber of lookahead fragmentsinvalid codec; use pcm_s32le or pcm_s32be sox  $BI;IwV;Iwbitrate is too high type=%x len=%i pkt_offset=%i Codec %dstray DTS-HD frame bad DTS syncword 0x%x HD mode not supported for this format Unknown DTS sample rate for HD DTS-HD bitrate too high, temporarily sending core only %i samples in DTS frame not supported Unrecognized large DTS frameSpecified HD rate of %d Hz would require an impossible repetition period of %d for the current DTS stream (blocks = %d, sample rate = %d) TrueHD samples per frame: %d delta_samples: %u, delta_bytes: %d Unusual frame timing: %u => %u, %d samples/frameTrueHD frame inserted, total size %d, buffer position %d Wrong AAC file format %u samples in AAC frame not supported Wrong MPEG file format version: %i layer: %i extension: %i spdifspdif_flagsIEC 61937 encapsulation flagsoutput in big-endian format (for use as s16be)dtshd_ratemux complete DTS frames in HD mode at the specified IEC958 rate (in Hz, default 0=disabled)dtshd_fallback_timemin secs to strip HD for after an overflow (-1: till the end, default 60)Insufficient timestamps in event number %d. %d %02d:%02d:%02d,%03d --> %02d:%02d:%02d,%03d X1:%03d X2:%03d Y1:%03d Y2:%03dSRT supports only a single subtitles stream. srtapplication/x-subripUTF16 is automatically converted to UTF8, do not specify a character encoding Dropping %d duplicated subtitle events Not enough data, skipping %zu bytes Skipping %zu bytes after last segment in frame supapplication/x-pgs\tag_len < 0x3flibavformat/swfenc.cSWF muxer only supports 1 audio stream SWF muxer only supports MP3 SWF muxer only supports 1 video stream SWF muxer only supports VP6, FLV1 and MJPEG FWSavm2Invalid (too large) frame rate %d/%d swf does not support that sample rate, choose from (44100, 22050, 11025). warning: Flash Player limit of 16000 frames reached audio fifo too small to mux audio essence application/x-shockwave-flashswfsetsockopt(SO_RCVBUF)setsockopt(SO_SNDBUF)setsockopt(TCP_NODELAY)setsockopt(TCP_MAXSEG)Port missing in uri Failed to resolve hostname %s: %s libavformat/tcp.cListen for incoming connectionsset timeout (in microseconds) of socket I/O operationsConnection awaiting timeout (in milliseconds)send_buffer_sizeSocket send buffer size (in bytes)recv_buffer_sizeSocket receive buffer size (in bytes)tcp_nodelayUse TCP_NODELAY to disable nagle's algorithmtcp_mssMaximum segment size for outgoing TCP packetsAll tee outputs failed. Slave muxer #%u failed, aborting. Slave muxer #%u failed: %s, continuing with %u/%u slaves. Error while sending packet to bitstream filter: %s selectonfailuse_fifofifo_optionsbsfsabortignoreInvalid onfail option value, valid options are 'abort' and 'ignore' true,y,yes,enable,enabled,on,1false,n,no,disable,disabled,off,0Error parsing fifo options: %s Invalid stream specifier '%s' for output '%s' Slave '%s': error opening: %s Slave '%s': error writing header: %s Specifier separator in '%s' is '%c', but only characters '%s' are allowed Invalid stream specifier '%s' in bsfs option '%s' for slave output '%s' spec:%s bsfs:%s matches stream %d of slave output '%s' Duplicate bsfs specification associated to stream %d of slave output '%s', filters will be ignored Error parsing bitstream filter sequence '%s' associated to stream %d of slave output '%s' Failed to create pass-through bitstream filter: %s Failed to initialize bitstream filter(s): %s |filename:'%s' format:%s stream:%d codec:%s type:%s bsfs: %s Input stream #%d is not mapped to any slave. teeTee muxerUse fifo pseudo-muxer to separate actual muxers from encoderfifo pseudo-muxer options[:]No option found near "%s" Only one stream is supported Invalid TTA extradata Sample rate too large TTA1Invalid frame durations audio/x-ttasetsockopt(IP_DROP_MEMBERSHIP)setsockopt(IPV6_DROP_MEMBERSHIP)pthread_join(): %s setsockopt(MCAST_JOIN_SOURCE_GROUP)setsockopt(MCAST_BLOCK_SOURCE)Source/block address %d is of incorrect protocol family setsockopt(IP_ADD_SOURCE_MEMBERSHIP)setsockopt(IP_BLOCK_SOURCE)Part of datagram lost due to insufficient buffer size Failed to set blocking modeCircular buffer overrun. Surviving due to overrun_nonfatal option Circular buffer overrun. To avoid, increase fifo_size URL option. To survive in such case, use overrun_nonfatal option len >= 0libavformat/udp.clen <= sizeof(s->tmp)len > 0reuseoverrun_nonfataludplite_coveragefifo_sizebitrateburst_bitslocaladdrsocket option UDPLITE_SEND_CSCOV not availablesocket option UDPLITE_RECV_CSCOV not availablebind failedgetnameinfo: %s setsockopt(IP_MULTICAST_TTL)setsockopt(IPV6_MULTICAST_HOPS)setsockopt(IP_ADD_MEMBERSHIP)setsockopt(IPV6_ADD_MEMBERSHIP)setsockopt(SO_RECVBUF)getsockopt(SO_RCVBUF)end receive buffer size reported is %d attempted to set receive buffer to size %d but it only ended up set as %d 'bitrate' option was set but 'circular_buffer_size' is not, but required pthread_mutex_init failed : %s pthread_cond_init failed : %s pthread_create failed : %s broadcastudpliteSystem data size (in bytes)Bits to send per secondMax length of bursts in bits (when using bitrate)Local portlocal_portLocal addresschoose UDPLite head size which should be validated by checksumMaximum UDP packet sizeexplicitly allow reusing UDP socketsreuse_socketexplicitly allow or disallow broadcast destinationTime to live (multicast only)set if connect() should be called on socketset the UDP receiving circular buffer size, expressed as a number of packets with size of 188 bytessurvive in case of UDP receiving circular buffer overrunset raise error timeout (only in read mode)%d, %10lld, %s, %d x %d, unknown, %d samples!"reached"libavformat/uncodedframecrcenc.cuncodedframecrc%s://%s@Px< 00123456789abcdef0123456789ABCDEFgn( 23 qb8D0!VNo7k|nl<"~_ 2h1gz) "3c#!3!V=}~O?TCx'p0h3Hgn 23 qb8D0!VNo7k|nl<n8@@PH@h1gz) *3b@Tf;B%d,!KF CL@dh1gn( 23 qb8D0!VNna>sM  sc 9[y24$񀀀 Ph1gz) "3c#!3!:Feje$2&4A#P+$iH0@.ƌA(L4<` ( h3Havformat_find_stream_infoFFmpeg version 4.3.1libavformat/utils.cunknown codecunspecified frame sizeunspecified sample formatunspecified sample rateunspecified number of channelsno decodable DTS framesunspecified sizeunspecified pixel formatno frame in rv30/40 and no sarprobing stream %d pp:%d Failed to reallocate probe buffer for stream %d nothing to probe for stream %d Probe with size=%d, packets=%d detected %s with score=%d probed stream %d probed stream %d failed extract_extradatathreads--prefix=/home/ffmpeg/install --enable-cross-compile --target-os=linux --cross-prefix=arm-ca9-linux-gnueabihf- --cc=arm-ca9-linux-gnueabihf-gcc --enable-shared --disable-static --arch=arm --cpu=armv7-a --enable-asm --enable-hwaccels --enable-gpl --disable-everything --disable-iconv --disable-zlib --disable-bzlib --enable-muxers --disable-filters --enable-encoders --enable-avformat --enable-postproc --enable-avdevice --enable-swresample --disable-hwaccels --enable-small --enable-decoder=aac --enable-decoder=mp2 --enable-decoder=mp3 --enable-encoder=aac --enable-encoder=mp3 --enable-demuxer=aac --enable-demuxer=mp3 --enable-demuxer=mov --enable-muxer=mp3 --enable-parser=aac --enable-protocol=file --enable-filter=scale --enable-filter=aresamplelibavformat license: GPL version 2 or later!dst->codec_whitelist && !dst->format_whitelist && !dst->protocol_whitelist && !dst->protocol_blacklistFailed to duplicate black/whitelist Truncating packet of size %d to %lld Format not on whitelist '%s' Attached picture on stream %d has invalid size, ignoring st->internal->avctx->ticks_per_frames->iformatDTS %lli < %lli out of order invalid dts/pts combination %lli first_dts %s not matching first dts %s (pts %s, duration %lld) in the queue IN delayed:%d pts:%s, dts:%s cur_dts:%s st:%d pc:%p duration:%lld delay:%d onein_oneout:%d OUTdelayed:%d/%d pts:%s, dts:%s cur_dts:%s st:%d (%d) first_dts %s but no packet with dts in the queue *pkt_bufferindex == 0 || ie[-1].timestamp < timestamptime_tolerance >= 0Protocol name not provided, cannot determine if input is local or a network protocol, buffers and access patterns cannot be configured optimally without knowing the protocol Reconfiguring buffers to size %lld Realloc buffer fail. tmp_pos > pos_maxgen_seek: %d %s ts_min < ts_maxpos_min=0x%llx pos_max=0x%llx dts_min=%s dts_max=%s pos_limit <= pos_max%lld %lld %lld / %s %s %s target:%s limit:%lld start:%lld noc:%d read_timestamp() failed in the middle read_seek: %d %s using cached pos_min=0x%llx dts_min=%s index < st->nb_index_entriesusing cached pos_max=0x%llx pos_limit=0x%llx dts_max=%s Failed to read extradata of size %d rfps: %f %f Setting avg frame rate based on r frame rate st->request_probe <= 0Packet corrupt (stream = %d, dts = %s), dropping it. pkt->stream_index < (unsigned)s->nb_streams && "Invalid stream index.\n"Demuxer context update while decoder is open, closing and trying to re-open Invalid timestamps stream=%d, pts=%s, dts=%s, size=%d ff_read_packet stream=%d, pts=%s, dts=%s, size=%d, duration=%lld, flags=%d parser not found for codec %s, packets or times may be invalid. demuxer injecting skip %d / discard %d Could not inject global side data read_frame_internal stream=%d, pts=%s, dts=%s, size=%d, duration=%lld, flags=%d st->index_entriesseek_frame_generic failed as this stream seems to contain no keyframes after the target timestamp, %d non keyframes found Ignoring outlier non primary stream starttime %f Ignoring outlier non primary stream endtime %f Ignoring outlier non primary stream duration %f s->nb_streams>0s->streams[ s->nb_streams - 1 ] == stnew_program: id=0x%04x Chapter end time %lld before start %lld stream index %d is not valid NTP time format roll over detected %0*dInput context has not been properly allocated by avformat_alloc_context() and is not NULL either Custom AVIOContext makes no sense and will be ignored with AVFMT_NOFILE format. Discarding ID3 tags because more suitable tags were found. demuxer does not support additional id3 data, skipping /?#.\st:%d removing common factor %d from timebase st:%d has too large timebase, reducing Ignoring attempt to set invalid timebase %d/%d for st:%d Number of streams exceeds max_streams parameter (%d), see the documentation if you wish to increase it Invalid stream specifier: %s. missing_streamsskip_clearBefore avformat_find_stream_info() pos: %lld bytes read:%lld seeks:%d nb_streams:%d Failed to open codec in %s interrupted All info found Probe buffer size limit of %lld bytes reached Stream #%d: not enough frames to estimate rate; consider increasing probesize Non-increasing DTS in stream %d: packet %d with DTS %lld, packet %d with DTS %lld DTS discontinuity in stream %d: packet %d with DTS %lld, packet %d with DTS %lld max_analyze_duration %lld reached at %lld microseconds st:%d !sti->avctx->extradatadecoding for stream %d failed start time for stream %d is not set in estimate_timings_from_pts Skipping duration calculation in estimate_timings_from_pts skip_changesstream %d : no PTS found at end of file, duration not set stream %d : no TS found at start of file, duration not set Estimating duration from bitrate, this may be inaccurate stream %d: start_time: %s duration: %s format: start_time: %s duration: %s (estimate from %s) bitrate=%lld kb/s Could not find codec parameters for stream %d (%s): %s Consider increasing the value for the 'analyzeduration' and 'probesize' options After avformat_find_stream_info() pos: %lld bytes read:%lld seeks:%d frames:%d !st->internal->bsfcUnknown bitstream filter '%s' Automatically inserted bitstream filter '%s'; args='%s' copyFailed to open bitstream filter %s for stream %d with codec %sFailed to parse creation_time %s Invalid palette side data mov,mp4,3gp,3g2,psp,ipod,ismv,f4vdvbsubdvbtxtmjpeg_2000mpegvideobit rateOnly WMV3 is accepted! vc1testrcv Creative Voice Fileaudio/x-voc%02d:%02d:%02d.%03dCHAPTERNAMEALBUMARTISTTRACKNUMBERDISCNUMBERDESCRIPTIONUnsupported pixel format (%d) _ZROۊdataOۊfactOۊfmt OۊwaveOۊriff.(No memory for peak data levlWriting local time and date to Peak Envelope Chunk %Y:%m:%d:%H:%M:%S:Failed to write timestamp Filesize %lld invalid for wav, output file will be broken wav_write_packet: NOPTS NONEds64WAVE files have exactly one stream fmt %s codec not supported in WAVE format factoriginatororiginator_referenceorigination_dateorigination_timetime_referenceumidcoding_history%s codec not supported for Peak Chunk Writing 16 bit peak for 8 bit audio does not make sense w64audio/x-wavWAV muxerwrite_bextWrite BEXT chunk.write_peakWrite Peak Envelope chunk.Do not write peak chunk.Append peak chunk after wav data.Write only peak chunk, omit wav data.rf64Use RF64 header rather than RIFF for large files.Write RF64 header if file grows large enough.alwaysAlways write RF64 header regardless of file size.neverNever write RF64 header regardless of file size.peak_block_sizeNumber of audio samples used to generate each peak frame.peak_formatThe format of the peak envelope data (1: uint8, 2: uint16).peak_ppvNumber of peak points per peak value (1 or 2).No header filename provided Invalid chunk filename template '%s' webm_chunkWebM Chunk Muxerchunk_start_indexstart index of the chunkfilename of the header where the initialization data will be writtenaudio_chunk_durationduration of each chunk in millisecondsfalsetruewebm_dash_manifest_durationurn:webm:dash:profile:webm-on-demand:20121280001000000The 'adaptation_sets' option must be set. 'id' in 'adaptation_sets' is malformed. Invalid value for 'streams' in adapation_sets. type="%s" mediaPresentationDuration="PT%gS" minBufferTime="PT%gS" profiles="%s"%s%Y-%m-%dT%H:%M:%SZ availabilityStartTime="%s" timeShiftBufferDepth="PT%gS" minimumUpdatePeriod="PT%dS" duration="PT%gS" > %.*sExactly one WebVTT stream is needed. WEBVTT text/vtt&mF_lv* mF_lꁟXVUYZo9g_J(sj(FoG\Q~^ZmJ"8S"GqFle:table.0.entries.timetable.0.entries.legacy_attribtimeline.table.0.entries.Eventstimelined?"1vids8qauds8q~^~^~^#-OE[~^[ICeZ) 7IN^tYppD;!=legacy_attrib8q~^table.0.header.timetable.0.redirector.legacy_attribtable.0.header.legacy_attribtimeline.table.0.header.Eventswctx->nb_index < 10libavformat/wtvenc.cunknown codec_type (0x%x) unsupported codec_id (0x%x) index < WTV_FILESunsupported file allocation table depth (%lli bytes) write stream codec info failed codec_type(0x%x) write stream codec failed codec_type(0x%x) write stream data failed codec_type(0x%x) WM/PictureWM/MediaThumbTypewtvThis muxer only supports a single WavPack stream. Invalid WavPack packet. wvaudio/x-wavpackERROR: Codec not supported. Warning: generating rarely used 4:1:1 YUV stream, some mjpegtools might not work. '%s' is not an official yuv4mpegpipe pixel format. Use '-strict -1' to encode to this pixel format. Warning: generating non standard YUV stream. Mjpegtools will not work. ERROR: yuv4mpeg can only handle yuv444p, yuv422p, yuv420p, yuv411p and gray8 pixel formats. And using 'strict -1' also yuv444p9, yuv422p9, yuv420p9, yuv444p10, yuv422p10, yuv420p10, yuv444p12, yuv422p12, yuv420p12, yuv444p14, yuv422p14, yuv420p14, yuv444p16, yuv422p16, yuv420p16, gray9, gray10, gray12 and gray16 pixel formats. Use -pix_fmt to select one. XCOLORRANGE=LIMITED XCOLORRANGE=FULL Cmono Cmono9 Cmono10 Cmono12 Cmono16 C411 XYSCSS=411 C420jpeg XYSCSS=420JPEG C422 XYSCSS=422 C444 XYSCSS=444 C420paldv XYSCSS=420PALDV C420mpeg2 XYSCSS=420MPEG2 C420p9 XYSCSS=420P9 C422p9 XYSCSS=422P9 C444p9 XYSCSS=444P9 C420p10 XYSCSS=420P10 C422p10 XYSCSS=422P10 C444p10 XYSCSS=444P10 C420p12 XYSCSS=420P12 C422p12 XYSCSS=422P12 C444p12 XYSCSS=444P12 C420p14 XYSCSS=420P14 C422p14 XYSCSS=422P14 C444p14 XYSCSS=444P14 C420p16 XYSCSS=420P16 C422p16 XYSCSS=422P16 C444p16 XYSCSS=444P16YUV4MPEG2%s W%d H%d F%d:%d I%c A%d:%d%s%s Error. YUV4MPEG stream header write failed. FRAMEThe pixel format '%s' is not supported. yuv4mpegpipey4mT@A M ?f s ? A V ,?o } 0@@$ * Am y @ : / Ƕ d ζ  ڶ  2   ! - 6 US J W \ i s 2 { ' Ƿ Ni ; 8_ Y@@Ժ ?n x A A D J  Լ ,A 4? L 0 z 4 (C L   P sx >wx @{x Ax ?x Bx 4x x x x x x { &k Nx ]x `x `x `x ex hRk mx :x :x :x nx nx n!O nx nx nx nx nx !x !y Xy X y X y Xy y y x }y #y (y ,y 0y 6y { #{ $? H AgR C{ $?]{ g{ $?{ { $?{ { $X  & ?@@ + j / d P C 2 j K s   0 C V i | ™ ou љ ' XAy \Af `C ` p? t?A] l? x?  h?D Q |@D D   D D ACLR#APRG&AALP&ARES'avssx&av1C@chplhco64\colr ctts2dinfDpxE@&drefedtselstendafieladrmftypglblhdlrilstjp2h&mdat{mdhd.mdiametaTminfmoofmoovtmvexmvhd,SMI %alac%avcCpasp|sidxstblstco\stpsstrfstschstsdstssstszsttsstz2sdtptkhd,tfdttfhdĕtrakNtraftreftmcdchapPtrexD)trunlDudtawaveesdstdac3dec3ddtsp0wide܄wfexcmov4~chandvc1sbgphvcCuuidCin(free!----$sinffrmasenc@ saizHsaiopsshschmвschitencаdfLast3dدsv3ddOps(dmlpSmDmLCoLLvpcCШmdcvclli<dvcCĢdvvCĢs ? ?" 2 ?M _ ? E ? @ m m  Y Y  cY cY   ?; F ?_ p     " / $? 0  ` p @ P P P P P P P P P P P P P P P x x  4A * 2 A F P lA A A 3 A A E - A P U @A A  A , 9 A S e A A @A A F 2 A @A A A I T A A A %  A B W A 8A A A * 4 A S ^ A z  A   <?  Do@  @o@3 " PA3 < TAV ` XAv  \A  hA  x  ? % L?AJ T $@n ~ A  @G W v    ?  ?[  @a Q a cY a M ] ?  ?o } @ $?F Q (? A:]  P A  `?@  d?@ & h?@< P l?o@< h s ?o@<   ?o@<   ?o@<   ?o@<   ?o@<   ?o@< 5 Q ?o@< n  ?o@<   p@@@  t@@@  x? XA , \r AR> P AR> O e AR>  AR>   AR>   AR> ) ? AR> e s ?  ?@  ?  AF * CF W  C   +4 `+4 +4tO+4 +4 +4S+4 +4 +4S+4 +4 +4DW+4 +4 +4R+4 +4 +4DW+4 +4 +4 qDW+4  +4 +4DW+4 `+4 +4 Y+4 +4 +4 \E+4 +4 +4 DW{F F 9@AF F @F F F @F #G *G @F {G G @F G G @F G G @F G G @F H $H @F 5H E ?WH hH  @F F @F F F @F #G *G @F {G G @F G G @F G G @F G G @F H $H @F 5H E ?F F @F F F @F #G *G @F {G G @F G G @F G G @F G G @F H $H @F 5H E ?Ƕ d P P P P P US Q - Q Q 'Q 2Q ;Q EQ MQ TQ YQ dQ S T AS T E AS  "T AS RT ^T AS T T ?aV oV AV V  @V V  @V V @BCgX h]d38pwX AwX X X AwX ] X P@KL@@CX X AX X @AtF H AtF X Y AtF ?Y FY AtF SY ZY AtF gY pY AtF Y Y AtF Y Y AtF Y Z AtF Z "Z AtF MZ VZ AtF oZ xZ AtF VZ AtF Z Z @AtF Z Z tF Z [ tF lF ([ tF F[ O[ ?[ [ XC[ [ `[ [ |A/\ 9\ h.Ah\ o\ Ah\ f@ Ah\ \ \ DA\ \ C] ] A4] B] A ] A] ] A] ] A] ] ^ A] 7^ @^ A] c U^ A]  ^ A] ^ ^ A] ^ ^ A] ^ ^ A] W_ a_ A] _ _ A] _ _ ?` !` C^` r` ?X ` ?` ` $A$a 5a 0CQa fa Ca a Aa a a Aa v b Aa a ab Aa b Aa b b Aa b b Aa c %c 2Amc c @mc m c Amc c c Amc c c Amc (d c Amc  2d 8 Wd gd d d  L D z Pd d TAd e X?Oe ae \ AJi E ?AA E Zi AJi E ?A| d |  | | P |  | - | + | / | ' | ' | 2 | F | +  dA A A * 4 A S ^ A z  A @ _@Y ^ Ap v  @{ t?f z ? ? ?9 J ?| C ? |3 A 3 A A3 4 @KLA .4 ?` wT D W c XAW e AW Pp'A + T<A• 2 H7 6 7 l1 D1 6 P1 (Z @ Ay A$ 5 AX i A ?ȿ п $A g ? @ h R O N M H \ R O N M t) H A d C | C9 A A , A^  A ) $?N ) $?6 [ ?5 AUe ? pA < (? u 0Aw 3  ? y Pbk PQk XY P] pd pj (P}j jj  1P, k X Pv i ,PcY : : F ' R W ]   L? " P@ =  j V  Q x  T? m    < B  s X@ \?@  d?@ Aj  ! A1 $  & ] u ? A A  (N@?M c 0Ab! P@6 d38K d38d\ȩ  x4P(Hlpخ,D`̱8TT||8`pܶxP$(l,ػDp lHd<0Ltx 4\@h$hH<(X0tXL$h@@PD\4 x,` d38Է n Ll 0d38Է n Ll 1 0d38ʺ d38 d d38n Ll | d38A t0 d38< d38 d38 d38 d38 d38 Hd38' 8d38W d38! d38r0 d380 d380 xd38x0 d380 hd38r3 d38H d388 (d38{ x5d38| 6d38Ll 9 7d38Y 7d38n Ll y 7d38) H=d38 Ad38p ` Ad38 Ad38 Ad38p Ad38p Ad38 Ad38Ђ   Ad38 0Kd38 Kd38 PLd38 PLd38 PLd38 PLd38 PLd38 Ld38 Rd38jF PUd38IH `Wd38H pYd38K J P n Ll K P S [d38U \d38V \d38#V \d387V \d38WV \d38hW X(o( 8 6 md38{ od38 qd38* 0xd381 0xd38 ~d38Q 8d38• d38] d38@ hd38 hd38 Ll Ll d38 `d38\ Pd38 Ѝd38t <` > < 8 h : @ & @ (n Ll %%%%%& 0 o9 z& P leqodoodoo>`o Ԟ <:  @ tJ P $ 3 ʵ < 07 $3 0 t p l n x W ,7 | ,  @ Po 2 h*  $  J H P[Ĉp <dp ܹ( ؀ $! # *  |7 l  ` Ll .Ђ ڵ z ܮ* k | ( z Z 2 p K O Dy y \ P< d 1 # - P0`$ 4 . 9 =\8X<Ա α Ա  !D  ,8--, (   P@Xh@_0H`IM   P@@_G`IM º xБ$ThQ4Q< < 0XDXHVP S P ]D[h l h P 0<8\X{ 5P, TxL CPȒ ,D  @  PAp||5AL  % CC  XHcDjcO Z ohop  `ts\sqq LL}~X}d}  D@  #,"  " P=D|HhԉĉS K S @Г lP  ,! ! ! a l/ / 0,i0  (\0  T\0   n0   0  ؔ n3 PATdI BM P xA00!9dfaI,Ah h h N $w w @&DNx Sx Ox ;P@DNx @ $$,` z $$`| | xD  6$p   xtD XD P(h     x@l $ 5 P@P4m8e|@T N T P x@ P4m8e||@l d u P x@LdP4m8e|@ ` xlutS v,vF J F (PwD\z) A Pl~6(pX$5o o P@@ > pT R \ pHV R N , N C0pa a b `] ] 9 L X 8c 8c #y #y <`z y y E 3@ x(} | PȞH ` ̐ N Q N Pd P  GCC: (Buildroot 2019.05.2) 6.5.0A6aeabi,7-A A  "*D.shstrtab.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.ARM.exidx.eh_frame.init_array.fini_array.jcr.data.rel.ro.dynamic.got.data.bss.comment.ARM.attributes oH "99z&%o>`>`V2odd8AoddP eeqY BllP b ] hX n0 0 t8 8 kR|p       ԞԞ (  FPP l0P !pq 7